Q08J23 (NSUN2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 71.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: tRNA (cytosine(34)-C(5))-methyltransferase EC=2.1.1.203 Alternative name(s): Myc-induced SUN domain-containing protein Short name=Misu NOL1/NOP2/Sun domain family member 2 Substrate of AIM1/Aurora kinase B tRNA (cytosine-5-)-methyltransferase tRNA methyltransferase 4 homolog Short name=hTrm4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 767 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | RNA methyltransferase that methylates tRNAs, and possibly RNA polymerase III transcripts. Methylates cytosine to 5-methylcytosine (m5C) at position 34 of intron-containing tRNA(Leu)(CAA) precursors. Not able to modify tRNAs at positions 48 or 49. May act downstream of Myc to regulate epidermal cell growth and proliferation. Required for proper spindle assembly and chromosome segregation, independently of its methyltransferase activity. Ref.8 Ref.11 |
| Catalytic activity | S-adenosyl-L-methionine + cytosine34 in tRNA precursor = S-adenosyl-L-homocysteine + 5-methylcytosine34 in tRNA precursor. Ref.8 |
| Subunit structure | Interacts with NPM1 and NCL during interphase; interaction is disrupted following phosphorylation at Ser-139. Ref.1 |
| Subcellular location | Nucleus › nucleolus. Cytoplasm › cytoskeleton › spindle. Note: Concentrated in the nucleolus during interphase and translocates to the spindle during mitosis as an RNA-protein complex that includes 18S ribosomal RNA. Ref.1 Ref.11 |
| Post-translational modification | Phosphorylated at Ser-139 by AURKB during mitosis, leading to abolish methyltransferase activity and the interaction with NPM1. Ref.1 |
| Involvement in disease | Mental retardation, autosomal recessive 5 (MRT5) [MIM:611091]: A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. |
| Sequence similarities | Belongs to the methyltransferase superfamily. RsmB/NOP family. TRM4 subfamily. |
| Sequence caution | The sequence BAA91075.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB14762.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q08J23-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q08J23-2) The sequence of this isoform differs from the canonical sequence as follows: 85-120: SHAKEILHCLKNKYFKELEDLEVDGQKVEVPQPLSW → R | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 767 | 767 | tRNA (cytosine(34)-C(5))-methyltransferase | PRO_0000289223 | |||||
Regions | |||||||||
| Region | 184 – 190 | 7 | S-adenosyl-L-methionine binding By similarity | ||||||
Sites | |||||||||
| Active site | 321 | 1 | Nucleophile Potential | ||||||
| Binding site | 215 | 1 | S-adenosyl-L-methionine By similarity | ||||||
| Binding site | 242 | 1 | S-adenosyl-L-methionine By similarity | ||||||
| Binding site | 268 | 1 | S-adenosyl-L-methionine By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 139 | 1 | Phosphoserine; by AURKB Ref.1 | ||||||
| Modified residue | 456 | 1 | Phosphoserine Ref.10 Ref.13 | ||||||
| Modified residue | 473 | 1 | Phosphoserine Ref.10 Ref.16 | ||||||
| Modified residue | 586 | 1 | N6-malonyllysine Ref.15 | ||||||
| Modified residue | 593 | 1 | Phosphoserine Ref.13 Ref.16 | ||||||
| Modified residue | 724 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 743 | 1 | Phosphoserine Ref.6 Ref.7 Ref.9 Ref.10 Ref.12 Ref.13 | ||||||
| Modified residue | 751 | 1 | Phosphoserine Ref.6 Ref.7 Ref.9 Ref.10 Ref.12 | ||||||
Natural variations | |||||||||
| Alternative sequence | 85 – 120 | 36 | SHAKE…QPLSW → R in isoform 2. | VSP_042621 | |||||
| Natural variant | 627 | 1 | V → I. Corresponds to variant rs2303708 [ dbSNP | Ensembl ]. | VAR_032604 | |||||
| Natural variant | 679 | 1 | G → R in MRT5; impairs proper intracellular localization. Ref.17 | VAR_068530 | |||||
Experimental info | |||||||||
| Mutagenesis | 139 | 1 | S → A: Induces a constitutive association with NPM1. Ref.1 | ||||||
| Mutagenesis | 139 | 1 | S → E: Mimicks constitutive phosphorylation and abolishes methyltransferase activity. Ref.1 | ||||||
| Sequence conflict | 316 | 1 | M → V in BAA91075. Ref.2 | ||||||
| Sequence conflict | 594 | 1 | G → D in BAB14762. Ref.2 | ||||||
| Sequence conflict | 605 | 1 | Q → R in BAF34150. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Aurora-B regulates RNA methyltransferase NSUN2." Sakita-Suto S., Kanda A., Suzuki F., Sato S., Takata T., Tatsuka M. Mol. Biol. Cell 18:1107-1117(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-139, INTERACTION WITH NPM1 AND NCL, MUTAGENESIS OF SER-139. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 209-767 (ISOFORM 1). |
| [3] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Placenta. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-743 AND SER-751, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-743 AND SER-751, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Identification of human tRNA:m5C methyltransferase catalysing intron-dependent m5C formation in the first position of the anticodon of the pre-tRNA Leu (CAA)." Brzezicha B., Schmidt M., Makalowska I., Jarmolowski A., Pienkowska J., Szweykowska-Kulinska Z. Nucleic Acids Res. 34:6034-6043(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY. |
| [9] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-743 AND SER-751, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-456; SER-473; SER-743 AND SER-751, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "The nucleolar RNA methyltransferase Misu (NSun2) is required for mitotic spindle stability." Hussain S., Benavente S.B., Nascimento E., Dragoni I., Kurowski A., Gillich A., Humphreys P., Frye M. J. Cell Biol. 186:27-40(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [12] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-743 AND SER-751, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [13] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-456; SER-593 AND SER-743, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "The first identification of lysine malonylation substrates and its regulatory enzyme." Peng C., Lu Z., Xie Z., Cheng Z., Chen Y., Tan M., Luo H., Zhang Y., He W., Yang K., Zwaans B.M., Tishkoff D., Ho L., Lombard D., He T.C., Dai J., Verdin E., Ye Y., Zhao Y. Mol. Cell. Proteomics 10:M111.012658.01-M111.012658.12(2011) [PubMed] [Europe PMC] [Abstract] Cited for: MALONYLATION AT LYS-586. |
| [16] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-473 AND SER-593, MASS SPECTROMETRY. |
| [17] | "Mutation in NSUN2, which encodes an RNA methyltransferase, causes autosomal-recessive intellectual disability." Khan M.A., Rafiq M.A., Noor A., Hussain S., Flores J.V., Rupp V., Vincent A.K., Malli R., Ali G., Khan F.S., Ishak G.E., Doherty D., Weksberg R., Ayub M., Windpassinger C., Ibrahim S., Frye M., Ansar M., Vincent J.B. Am. J. Hum. Genet. 90:856-863(2012) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT MRT5 ARG-679, CHARACTERIZATION OF VARIANT MRT5 ARG-679. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB255451 mRNA. Translation: BAF34150.1. AK000310 mRNA. Translation: BAA91075.1. Different initiation. AK023994 mRNA. Translation: BAB14762.1. Different initiation. AK298980 mRNA. Translation: BAG61074.1. AC010366 Genomic DNA. No translation available. AC027334 Genomic DNA. No translation available. CH471102 Genomic DNA. Translation: EAX08105.1. BC001041 mRNA. Translation: AAH01041.3. BC137083 mRNA. Translation: AAI37084.1. |
| IPI | IPI00306369. IPI00966877. |
| RefSeq | NP_001180384.1. NM_001193455.1. NP_060225.4. NM_017755.5. |
| UniGene | Hs.481526. |
3D structure databases | |
| ProteinModelPortal | Q08J23. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q08J23. 7 interactions. |
| STRING | 9606.ENSP00000264670. |
PTM databases | |
| PhosphoSite | Q08J23. |
Polymorphism databases | |
| DMDM | 148887180. |
Proteomic databases | |
| PaxDb | Q08J23. |
| PeptideAtlas | Q08J23. |
| PRIDE | Q08J23. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000264670; ENSP00000264670; ENSG00000037474. ENST00000506139; ENSP00000420957; ENSG00000037474. |
| GeneID | 54888. |
| KEGG | hsa:54888. |
| UCSC | uc003jdt.3. human. |
Organism-specific databases | |
| CTD | 54888. |
| GeneCards | GC05M006654. |
| H-InvDB | HIX0004733. |
| HGNC | HGNC:25994. NSUN2. |
| HPA | HPA037896. |
| MIM | 610916. gene. 611091. phenotype. |
| neXtProt | NX_Q08J23. |
| Orphanet | 88616. Autosomal recessive nonsyndromic intellectual deficit. 235. Dubowitz syndrome. |
| PharmGKB | PA134953940. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0144. |
| HOGENOM | HOG000205147. |
| HOVERGEN | HBG106711. |
| InParanoid | Q08J23. |
| KO | K15335. |
| OMA | PIEKFYA. |
| OrthoDB | EOG4K9BBQ. |
| PhylomeDB | Q08J23. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS12087-MONOMER. |
| Pathway_Interaction_DB | aurora_b_pathway. Aurora B signaling. |
Gene expression databases | |
| ArrayExpress | Q08J23. |
| Bgee | Q08J23. |
| CleanEx | HS_NSUN2. |
| Genevestigator | Q08J23. |
Family and domain databases | |
| InterPro | IPR001678. Fmu/NOL1/Nop2p. IPR023267. RCMT. IPR023270. RCMT_NCL1. [Graphical view] |
| Pfam | PF01189. Nol1_Nop2_Fmu. 1 hit. [Graphical view] |
| PRINTS | PR02008. RCMTFAMILY. PR02011. RCMTNCL1. |
| PROSITE | PS01153. NOL1_NOP2_SUN. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | NSUN2. human. |
| GenomeRNAi | 54888. |
| NextBio | 57879. |
| SOURCE | Search... |
Entry information
| Entry name | NSUN2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q08J23 Secondary accession number(s): B2RNR4 Q9NXD9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
