Q08874 (MITF_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Microphthalmia-associated transcription factor | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 526 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcription factor that regulates the expression of genes with essential roles in cell differentiation, proliferation and survival. Binds to symmetrical DNA sequences (E-boxes) (5'-CACGTG-3') found in the promoters of target genes, such as BCL2 and tyrosinase (TYR). Plays an important role in melanocyte development by regulating the expression of tyrosinase (TYR) and tyrosinase-related protein 1 (TYRP1). Plays a critical role in the differentiation of various cell types, such as neural crest-derived melanocytes, mast cells, osteoclasts and optic cup-derived retinal pigment epithelium. |
| Subunit structure | Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA in the form of homodimer or heterodimer with either TFE3, TFEB or TFEC. Identified in a complex with HINT1 and CTNNB1 By similarity. Interacts with KARS. Ref.8 |
| Subcellular location | |
| Tissue specificity | In the adult, expressed at high levels in the heart, skin, skeletal muscle, intestine, stomach, kidney, ovary, lung, spleen and brain. In the embryo, expressed in developing eye, ear, skin and heart. Isoform M is expressed in melanocytes and also in the embryonic and adult heart while isoform A and isoform H are more widely expressed. Ref.1 |
| Post-translational modification | Phosphorylation at Ser-405 significantly enhances the ability to bind the tyrosinase promoter. Phosphorylated at Ser-180 and Ser-516 following KIT signaling, trigerring a short live activation: Phosphorylation at Ser-180 and Ser-516 by MAPK and RPS6KA1, respectively, activate the transcription factor activity but also promote ubiquitination and subsequent degradation by the proteasome By similarity. Ubiquitinated following phosphorylation at Ser-180, leading to subsequent degradation by the proteasome. Deubiquitinated by USP13, preventing its degradation By similarity. |
| Involvement in disease | Defects in Mitf are the cause of microphthalmia (mi), a condition characterized by loss of pigmentation; reduced eye size; failure of secondary bone resorption; reduced numbers of mast cells; early onset of deafness, and which gives rise to a number of different phenotypes. Among them, microphthalmia-eyeless white (mi-ew) has a normal appearance at the heterozygous state, but shows white coat; eyes almost absent and eyelids never open at homozygosity. Microphthalmia-black and white spot (mi-bws) is normal at heterozygosity, and presents white spots and black eyes at homozygous state. Microphthalmia-white (mi-wh) has reduced coat color and eye pigmentation; spots on toes, tail and belly; inner ear defects at heterozygosity, and at homozygosity shows white coat; eyes small and inner iris slightly pigmented; spinal ganglia, adrenal medulla and dermis smaller than normal, and inner ear defects. Microphthalmia-vitiligo (mi-vi) has normal phenotype at heterozygosity, but shows gradual depigmentation of coat, skin and eyes; and retinal degeneration at homozygosity. Microphthalmia-spotted (mi-sp) shows normal phenotype; at homozygosity, however, tyrosinase activity in skin is reduced. Microphthalmia-defective irism (mi-di) has reduced retinal pigmentation at heterozygosity and shows white coat; eyes of reduced sized and possible mild osteoporosis at homozygosity. Microphthalmia-cloudy eyed (mi-ce) has a normal appearance at the heterozygous state, but shows white coat; eyes of reduced size and unpigmented at homozygosity. Microphthalmia-red-eyed white (mi-rw) has a normal appearance at the homozygous state, but shows white coat with one or more pigmented spots around the head/and or tail; eyes are small and red at heterozygosity. Microphthalmia-black-eyed white (mi-bw) shows a white coat but normal sized eyes which reamin black at homozygosity. |
| Sequence similarities | Belongs to the MiT/TFE family. Contains 1 bHLH (basic helix-loop-helix) domain. |
Ontologies
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q08874-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A1 (identifier: Q08874-2) The sequence of this isoform differs from the canonical sequence as follows: 139-194: Missing. | ||||||
| Isoform A2 (identifier: Q08874-3) The sequence of this isoform differs from the canonical sequence as follows: 119-222: Missing. 294-299: Missing. 318-319: LI → LSKFV | ||||||
| Isoform H (identifier: Q08874-4) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSS → MEALRFEMLIPCSFESLCL | ||||||
| Isoform H1 (identifier: Q08874-5) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSS → MEALRFEMLIPCSFESLCL 119-254: Missing. | ||||||
| Isoform H2 (identifier: Q08874-6) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSS → MEALRFEMLIPCSFESLCL 119-254: Missing. 294-319: ACIFPTESEARALAKERQKKDNHNLI → V | ||||||
| Isoform H3 (identifier: Q08874-7) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSS → MEALRFEMLIPCSFESLCL 139-194: Missing. | ||||||
| Isoform M (identifier: Q08874-8) The sequence of this isoform differs from the canonical sequence as follows: 1-118: MQSESGIVPD...ATQVPMEVLK → MLEMLEYSHYQ | ||||||
| Isoform M1 (identifier: Q08874-9) The sequence of this isoform differs from the canonical sequence as follows: 1-118: MQSESGIVPD...ATQVPMEVLK → MLEMLEYSHYQ 294-299: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||
Molecule processing | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 526 | 526 | Microphthalmia-associated transcription factor | PRO_0000127277 | |||||||||||
Regions | |||||||||||||||
| Domain | 311 – 364 | 54 | bHLH | ||||||||||||
| Region | 224 – 291 | 68 | Transactivation By similarity | ||||||||||||
| Region | 374 – 395 | 22 | Leucine-zipper | ||||||||||||
| Region | 401 – 431 | 31 | DNA binding regulation By similarity | ||||||||||||
Amino acid modifications | |||||||||||||||
| Modified residue | 180 | 1 | Phosphoserine; by MAPK By similarity | ||||||||||||
| Modified residue | 405 | 1 | Phosphoserine; by GSK3 By similarity | ||||||||||||
| Modified residue | 414 | 1 | Phosphoserine Ref.9 | ||||||||||||
| Modified residue | 491 | 1 | Phosphoserine By similarity | ||||||||||||
| Modified residue | 516 | 1 | Phosphoserine; by RPS6KA1 By similarity | ||||||||||||
| Cross-link | 289 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | |||||||||||||
| Cross-link | 423 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | |||||||||||||
Natural variations | |||||||||||||||
| Alternative sequence | 1 – 118 | 118 | MQSES…MEVLK → MLEMLEYSHYQ in isoform M and isoform M1. | VSP_002130 | |||||||||||
| Alternative sequence | 1 – 35 | 35 | MQSES…PLKSS → MEALRFEMLIPCSFESLCL in isoform H, isoform H1, isoform H2 and isoform H3. | VSP_002129 | |||||||||||
| Alternative sequence | 119 – 254 | 136 | Missing in isoform H1 and isoform H2. | VSP_002132 | |||||||||||
| Alternative sequence | 119 – 222 | 104 | Missing in isoform A2. | VSP_002131 | |||||||||||
| Alternative sequence | 139 – 194 | 56 | Missing in isoform A1 and isoform H3. | VSP_002133 | |||||||||||
| Alternative sequence | 294 – 319 | 26 | ACIFP…NHNLI → V in isoform H2. | VSP_002135 | |||||||||||
| Alternative sequence | 294 – 299 | 6 | Missing in isoform A2 and isoform M1. | VSP_002134 | |||||||||||
| Alternative sequence | 318 – 319 | 2 | LI → LSKFV in isoform A2. | VSP_002136 | |||||||||||
| Natural variant | 36 – 118 | 83 | Missing in microphthalmia-red-eyed white/mi-rw. | ||||||||||||
| Natural variant | 119 – 254 | 136 | Missing in microphthalmia-white spot/mi-ws. | ||||||||||||
| Natural variant | 139 – 194 | 56 | Missing in microphthalmia-black and white spot/mi-bws. | ||||||||||||
| Natural variant | 294 – 319 | 26 | ACIFP…NHNLI → V in microphthalmia-eyeless-white/mi-ew. | ||||||||||||
| Natural variant | 294 – 299 | 6 | Missing in microphthalmia-spotted/mi-sp. | ||||||||||||
| Natural variant | 319 | 1 | I → N in microphthalmia-white/mi-wh. | ||||||||||||
| Natural variant | 323 | 1 | Missing in microphthalmia/mi. | ||||||||||||
| Natural variant | 329 | 1 | D → N in microphthalmia-vitiligo/mi-vi. | ||||||||||||
| Natural variant | 370 – 526 | 157 | Missing in microphthalmia-cloudy-eyed/mi-ce and microphthalmia-defective iris/mi-di. | ||||||||||||
Experimental info | |||||||||||||||
| Sequence conflict | 41 | 1 | P → S in AAF81266. Ref.2 | ||||||||||||
| Sequence conflict | 41 | 1 | P → S in AAF81267. Ref.2 | ||||||||||||
| Sequence conflict | 41 | 1 | P → S in AAF81268. Ref.2 | ||||||||||||
| Sequence conflict | 41 | 1 | P → S in AAF81269. Ref.2 | ||||||||||||
| Sequence conflict | 41 | 1 | P → S in AAF81270. Ref.2 | ||||||||||||
| Sequence conflict | 41 | 1 | P → S in AAF81271. Ref.2 | ||||||||||||
| Sequence conflict | 41 | 1 | P → S in AAF81272. Ref.2 | ||||||||||||
| Sequence conflict | 48 | 1 | I → L in AAF81266. Ref.2 | ||||||||||||
| Sequence conflict | 48 | 1 | I → L in AAF81267. Ref.2 | ||||||||||||
| Sequence conflict | 48 | 1 | I → L in AAF81268. Ref.2 | ||||||||||||
| Sequence conflict | 48 | 1 | I → L in AAF81269. Ref.2 | ||||||||||||
| Sequence conflict | 48 | 1 | I → L in AAF81270. Ref.2 | ||||||||||||
| Sequence conflict | 48 | 1 | I → L in AAF81271. Ref.2 | ||||||||||||
| Sequence conflict | 48 | 1 | I → L in AAF81272. Ref.2 | ||||||||||||
| Sequence conflict | 52 | 1 | S → T in AAF81266. Ref.2 | ||||||||||||
| Sequence conflict | 52 | 1 | S → T in AAF81267. Ref.2 | ||||||||||||
| Sequence conflict | 52 | 1 | S → T in AAF81268. Ref.2 | ||||||||||||
| Sequence conflict | 52 | 1 | S → T in AAF81269. Ref.2 | ||||||||||||
| Sequence conflict | 52 | 1 | S → T in AAF81270. Ref.2 | ||||||||||||
| Sequence conflict | 52 | 1 | S → T in AAF81271. Ref.2 | ||||||||||||
| Sequence conflict | 52 | 1 | S → T in AAF81272. Ref.2 | ||||||||||||
Secondary structure | |||||||||||||||
Helix Strand Turn | |||||||||||||||
| Helix | 324 – 337 | 14 | |||||||||||||
| Helix | 350 – 366 | 17 | |||||||||||||
| Helix | 368 – 401 | 34 | |||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mutations at the mouse microphthalmia locus are associated with defects in a gene encoding a novel basic-helix-loop-helix-zipper protein." Hodgkinson C.A., Moore K.J., Nakayama A., Steingrimsson E., Copeland N.G., Jenkins N.A., Arnheiter H. Cell 74:395-404(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS M AND M1), VARIANTS MI AND MI-WS, TISSUE SPECIFICITY. Tissue: Melanocyte. |
| [2] | "Genomic, transcriptional and mutational analysis of the mouse microphthalmia locus." Hallsson J.H., Favor J., Hodgkinson C., Glaser T., Lamoreux M.L., Magnusdottir R., Gunnarsson G.J., Sweet H.O., Copeland N.G., Jenkins N.A., Steingrimsson E. Genetics 155:291-300(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING, MUTAGENESIS. Strain: 129/Sv. Tissue: Heart. |
| [3] | Hallsson J.H., Favor J., Hodgkinson C., Glaser T., Lamoreux M.L., Magnusdottir R., Gunnarsson G.J., Sweet H.O., Copeland N.G., Jenkins N.A., Steingrimsson E. Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION TO 41; 48; 52 AND 91. |
| [4] | "Molecular basis of mouse microphthalmia (mi) mutations helps explain their developmental and phenotypic consequences." Steingrimsson E., Moore K.J., Lamoreux M.L., Ferre-D'Amare A.R., Burley S.K., Sanders Zimring D.C., Skow L.C., Hodgkinson C.A., Arnheiter H., Copeland N.G., Jenkins N.A. Nat. Genet. 8:256-263(1994) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS H AND M), VARIANTS. Strain: C57BL/6. Tissue: Heart and Melanocyte. |
| [5] | "A helix-loop-helix transcription factor-like gene is located at the mi locus." Hughes M.J., Lingrel J.B., Krakowsky J.M., Anderson K.P. J. Biol. Chem. 268:20687-20690(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 345-392. Strain: C57BL/6. Tissue: Heart. |
| [6] | "Identification of a novel isoform of microphthalmia-associated transcription factor that is enriched in retinal pigment epithelium." Amae S., Fuse N., Yasumoto K., Sato S., Yajima I., Yamamoto H., Udono T., Durlu Y.K., Tamai M., Takahashi K., Shibahara S. Biochem. Biophys. Res. Commun. 247:710-715(1998) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). |
| [7] | "The recessive phenotype displayed by a dominant negative microphthalmia-associated transcription factor mutant is a result of impaired nucleation potential." Takebayashi K., Chida K., Tsukamoto I., Morii E., Munakata H., Arnheiter H., Kuroki T., Kitamura Y., Nomura S. Mol. Cell. Biol. 16:1203-1211(1996) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [8] | "The function of lysyl-tRNA synthetase and Ap4A as signaling regulators of MITF activity in FcepsilonRI-activated mast cells." Lee Y.N., Nechushtan H., Figov N., Razin E. Immunity 20:145-151(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KARS. |
| [9] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-414, MASS SPECTROMETRY. Tissue: Melanoma. |
| [10] | "An L1 element intronic insertion in the black-eyed white (Mitfmi-bw) gene: the loss of a single Mitf isoform responsible for the pigmentary defect and inner ear deafness." Yajima I., Sato S., Kimura T., Yasumoto K., Shibahara S., Goding C.R., Yamamoto H. Hum. Mol. Genet. 8:1431-1441(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT MI-BW. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Z23066 mRNA. Translation: CAA80600.1. AF222344 Genomic DNA. Translation: AAF63466.1. AF222959 AF222958 Genomic DNA. Translation: AAF81266.2.AF222959 AF222958 Genomic DNA. Translation: AAF81267.2.AF222959 AF222958 Genomic DNA. Translation: AAF81268.2.AF222959 AF222958 Genomic DNA. Translation: AAF81269.2.AF222959 AF222958 Genomic DNA. Translation: AAF81270.2.AF222959 AF222958 Genomic DNA. Translation: AAF81271.2.AF222959 AF222958 Genomic DNA. Translation: AAF81272.2.AF222952 Genomic DNA. No translation available. U19874 mRNA. Translation: AAC52155.1. U19875 mRNA. Translation: AAC52156.1. L22958 mRNA. Translation: AAB47773.1. AB009397 mRNA. Translation: BAA32329.1. | ||||||||||||||||||||||||
| IPI | IPI00125758. IPI00230195. IPI00230196. IPI00230197. IPI00230198. IPI00230199. IPI00230200. IPI00230201. IPI00230202. | ||||||||||||||||||||||||
| PIR | A40728. I49244. PD0026. | ||||||||||||||||||||||||
| RefSeq | NP_032627.1. NM_008601.3. | ||||||||||||||||||||||||
| UniGene | Mm.333284. Mm.454504. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q08874. | ||||||||||||||||||||||||
| SMR | Q08874. Positions 324-402. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q08874. 1 interaction. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q08874. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q08874. | ||||||||||||||||||||||||
| PRIDE | Q08874. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENSMUST00000043628; ENSMUSP00000044459; ENSMUSG00000035158. | ||||||||||||||||||||||||
| GeneID | 17342. | ||||||||||||||||||||||||
| KEGG | mmu:17342. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 4286. | ||||||||||||||||||||||||
| MGI | MGI:104554. Mitf. | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG251286. | ||||||||||||||||||||||||
| HOVERGEN | HBG006768. | ||||||||||||||||||||||||
| InParanoid | Q08874. | ||||||||||||||||||||||||
| KO | K09455. | ||||||||||||||||||||||||
| OrthoDB | EOG495ZRR. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q08874. | ||||||||||||||||||||||||
| Bgee | Q08874. | ||||||||||||||||||||||||
| CleanEx | MM_MITF. MM_VIT. | ||||||||||||||||||||||||
| Genevestigator | Q08874. | ||||||||||||||||||||||||
| GermOnline | ENSMUSG00000035158. Mus musculus. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 4.10.280.10. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR011598. bHLH_dom. IPR024097. bHLH_ZIP_TF. IPR021802. bHLH_ZIP_TF_MiT/TFE. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR10014. PTHR10014. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF11851. DUF3371. 1 hit. PF00010. HLH. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00353. HLH. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF47459. HLH_basic. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS50888. BHLH. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChEMBL | CHEMBL1075142. | ||||||||||||||||||||||||
| ChiTaRS | MITF. mouse. | ||||||||||||||||||||||||
| NextBio | 291916. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | MITF_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q08874 Secondary accession number(s): O08885 Q9JKX9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
