Q08648 (SG11B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sperm-associated antigen 11B Alternative name(s): Human epididymis-specific protein 2 Short name=He2 Protein EP2 Sperm antigen HE2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 103 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | |
| Tissue specificity | Specifically expressed in caput and proximal corpus of epididymis. Present in the epididymal epithelium and on the sperm surface, with a subacrosomal equatorial distribution on the sperm head. |
| Polymorphism | The microheterogeneity probably represents an allelic variant. |
| Sequence similarities | Belongs to the SPAG11 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | spermatogenesis Traceable author statement Ref.1. Source: ProtInc |
| Cellular_component | extracellular region Non-traceable author statement Ref.2. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] Note: Exon 6 is read in two different reading frames, one resulting in the N-terminal amino acid sequences of EP2A, EP2B and EP2F and the other in the N-terminal sequences of EP2D, EP2E and EP2G. | ||||||
| Isoform EP2A (identifier: Q08648-1) Also known as: HE2 alpha1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform EP2B (identifier: Q08648-2) The sequence of this isoform differs from the canonical sequence as follows: 1-71: MRQRLLPSVT...LLPPRTPPYQ → MKVFFLFAVLFCLVQTNS | ||||||
| Isoform EP2C (identifier: Q08648-3) Also known as: HE2C; The sequence of this isoform differs from the canonical sequence as follows: 72-103: VHISHREARGPSFRICVDFLGPRWARGCSTGN → EPASDLKVVDCRRSEGFCQEYCNYMETQVGYCSKKKDACCLH | ||||||
| Isoform EP2D (identifier: Q08648-4) Also known as: HE2 beta1; The sequence of this isoform differs from the canonical sequence as follows: 72-103: VHISHREARGPSFRICVDFLGPRWARGCSTGN → GDVPPGIRNT...KPEMDGRSGI | ||||||
| Isoform EP2E (identifier: Q08648-5) The sequence of this isoform differs from the canonical sequence as follows: 1-80: MRQRLLPSVT...QVHISHREAR → MKVFFLFAVL...KPEMDGRSGI 81-103: Missing. | ||||||
| Isoform EP2F (identifier: Q08648-6) The sequence of this isoform is not available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Potential | ||||||
| Chain | 26 – 103 | 78 | Sperm-associated antigen 11B | PRO_0000033185 | |||||
Amino acid modifications | |||||||||
| Glycosylation | 29 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 80 | 80 | MRQRL…HREAR → MKVFFLFAVLFCLVQTNSGD VPPGIRNTICHMQQGICRLF FCHSGEKKRDICSDPWNRCC VSNTDEEGKEKPEMDGRSGI in isoform EP2E. | VSP_044926 | |||||
| Alternative sequence | 1 – 71 | 71 | MRQRL…TPPYQ → MKVFFLFAVLFCLVQTNS in isoform EP2B. | VSP_006208 | |||||
| Alternative sequence | 72 – 103 | 32 | VHISH…CSTGN → EPASDLKVVDCRRSEGFCQE YCNYMETQVGYCSKKKDACC LH in isoform EP2C. | VSP_006209 | |||||
| Alternative sequence | 72 – 103 | 32 | VHISH…CSTGN → GDVPPGIRNTICRMQQGICR LFFCHSGEKKRDICSDPWNR CCVSNTDEEGKEKPEMDGRS GI in isoform EP2D. | VSP_006210 | |||||
| Alternative sequence | 81 – 103 | 23 | Missing in isoform EP2E. | VSP_044927 | |||||
| Natural variant | 77 | 1 | R → Q. Ref.3 Corresponds to variant rs2853658 [ dbSNP | Ensembl ]. | VAR_005269 | |||||
| Natural variant | 89 | 1 | D → G. Corresponds to variant rs2738035 [ dbSNP | Ensembl ]. | VAR_053683 | |||||
Experimental info | |||||||||
| Isoform EP2C: | |||||||||
| Sequence conflict | 18 | 1 | L → C in CAG25732. Ref.4 | ||||||
| Isoform EP2E: | |||||||||
| Sequence conflict | 31 | 1 | H → R in AAG21882. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a novel human sperm antigen (HE2) specifically expressed in the proximal epididymis." Osterhoff C., Kirchhoff C., Krull N., Ivell R. Biol. Reprod. 50:516-525(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EP2A). |
| [2] | "HE2 beta and HE2 gamma, new members of an epididymis-specific family of androgen-regulated proteins in the human." Hamil K.G., Sivashanmugam P., Richardson R.T., Grossman G., Ruben S.M., Mohler J.L., Petrusz P., O'Rand M.G., French F.S., Hall S.H. Endocrinology 141:1245-1253(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP2A AND EP2D). |
| [3] | "Organization of the human gene encoding the epididymis-specific EP2 protein variants and its relationship to defensin genes." Frohlich O., Po C., Young L.G. Biol. Reprod. 64:1072-1079(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS EP2A; EP2B; EP2C; EP2D AND EP2E), VARIANT GLN-77. |
| [4] | "SPAG11/Isoform HE2C, an atypical anionic beta-defensin-like peptide of the proximal human epididymis." von Horsten H.H., Derr P., Schaefer B., Kirchhoff C. Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EP2C). |
| [5] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X67697 mRNA. Translation: CAA47927.1. AF168616 mRNA. Translation: AAF37186.1. AF168617 mRNA. Translation: AAF37187.1. AY005129 Genomic DNA. Translation: AAG21878.1. AY005129 Genomic DNA. Translation: AAG21879.1. AY005129 Genomic DNA. Translation: AAG21880.1. AY005129 Genomic DNA. Translation: AAG21881.1. AY005129 Genomic DNA. Translation: AAG21882.1. AY005129 Genomic DNA. Translation: AAG21883.1. AJ628017 mRNA. Translation: CAF31328.1. AJ635328 mRNA. Translation: CAG25732.1. AC130360 Genomic DNA. No translation available. |
| IPI | IPI00220126. IPI00220127. IPI00792134. IPI00793278. IPI00794932. |
| PIR | I37454. |
| RefSeq | NP_057596.1. NM_016512.3. NP_478107.2. NM_058200.2. NP_478108.2. NM_058201.2. NP_478109.1. NM_058202.2. NP_478110.1. NM_058203.2. NP_478113.2. NM_058206.3. NP_478114.2. NM_058207.2. |
| UniGene | Hs.2717. |
3D structure databases | |
| ProteinModelPortal | Q08648. |
| ModBase | Search... |
Polymorphism databases | |
| DMDM | 93141314. |
Proteomic databases | |
| PRIDE | Q08648. |
Protocols and materials databases | |
| DNASU | 10407. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000297498; ENSP00000297498; ENSG00000164871. ENST00000317900; ENSP00000322591; ENSG00000164871. ENST00000458665; ENSP00000398550; ENSG00000164871. ENST00000528168; ENSP00000431230; ENSG00000164871. |
| GeneID | 10407. |
| KEGG | hsa:10407. |
| UCSC | uc003wri.3. human. uc003wrk.3. human. uc003wrm.3. human. |
Organism-specific databases | |
| CTD | 10407. |
| GeneCards | GC08M007294. |
| HGNC | HGNC:14534. SPAG11B. |
| MIM | 606560. gene. |
| neXtProt | NX_Q08648. |
| PharmGKB | PA37894. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG121990. |
| HOVERGEN | HBG073275. |
| OMA | NCKKSEG. |
Gene expression databases | |
| ArrayExpress | Q08648. |
| Bgee | Q08648. |
| Genevestigator | Q08648. |
| GermOnline | ENSG00000164871. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007988. Sperm_Ag_HE2. [Graphical view] |
| Pfam | PF05324. Sperm_Ag_HE2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SPAG11B. human. |
| GenomeRNAi | 10407. |
| NextBio | 39435. |
| SOURCE | Search... |
Entry information
| Entry name | SG11B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q08648 Secondary accession number(s): E9PFH0 Q9NRV8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
