Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sperm-associated antigen 11B

Gene

SPAG11B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Biological processi

  • spermatogenesis Source: ProtInc
Complete GO annotation...

Protein family/group databases

TCDBi1.C.85.1.5. the pore-forming -defensin (-defensin) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Sperm-associated antigen 11B
Alternative name(s):
Human epididymis-specific protein 2
Short name:
He2
Protein EP2
Sperm antigen HE2
Gene namesi
Name:SPAG11B
Synonyms:EP2, HE2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:14534. SPAG11B.

Subcellular locationi

GO - Cellular componenti

  • extracellular region Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37894.

Polymorphism and mutation databases

BioMutaiSPAG11B.
DMDMi93141314.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525Sequence analysisAdd
BLAST
Chaini26 – 10378Sperm-associated antigen 11BPRO_0000033185Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi29 – 291N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ08648.
PeptideAtlasiQ08648.
PRIDEiQ08648.

Expressioni

Tissue specificityi

Specifically expressed in caput and proximal corpus of epididymis. Present in the epididymal epithelium and on the sperm surface, with a subacrosomal equatorial distribution on the sperm head.

Gene expression databases

BgeeiQ08648.
ExpressionAtlasiQ08648. baseline.
GenevisibleiQ08648. HS.

Interactioni

Protein-protein interaction databases

BioGridi115678. 1 interaction.
IntActiQ08648. 1 interaction.
STRINGi9606.ENSP00000316012.

Structurei

3D structure databases

ProteinModelPortaliQ08648.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SPAG11 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410JFGU. Eukaryota.
ENOG4111B8J. LUCA.
GeneTreeiENSGT00840000130147.
HOGENOMiHOG000266967.
HOVERGENiHBG073275.
InParanoidiQ08648.
OMAiNCKRSEG.
PhylomeDBiQ08648.

Family and domain databases

InterProiIPR007988. Sperm_Ag_HE2.
[Graphical view]
PfamiPF05324. Sperm_Ag_HE2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Exon 6 is read in two different reading frames, one resulting in the N-terminal amino acid sequences of EP2A, EP2B and EP2F and the other in the N-terminal sequences of EP2D, EP2E and EP2G.

Isoform EP2A (identifier: Q08648-1) [UniParc]FASTAAdd to basket

Also known as: HE2 alpha1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRQRLLPSVT SLLLVALLFP GSSQARHVNH SATEALGELR ERAPGQGTNG
60 70 80 90 100
FQLLRHAVKR DLLPPRTPPY QVHISHREAR GPSFRICVDF LGPRWARGCS

TGN
Length:103
Mass (Da):11,431
Last modified:April 18, 2006 - v4
Checksum:iABDD1CE4BB54ABD3
GO
Isoform EP2B (identifier: Q08648-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MRQRLLPSVT...LLPPRTPPYQ → MKVFFLFAVLFCLVQTNS

Show »
Length:50
Mass (Da):5,673
Checksum:iA91640B5802DCDD1
GO
Isoform EP2C (identifier: Q08648-3) [UniParc]FASTAAdd to basket

Also known as: HE2C

The sequence of this isoform differs from the canonical sequence as follows:
     72-103: VHISHREARGPSFRICVDFLGPRWARGCSTGN → EPASDLKVVDCRRSEGFCQEYCNYMETQVGYCSKKKDACCLH

Show »
Length:113
Mass (Da):12,687
Checksum:iF962A417664352A3
GO
Isoform EP2D (identifier: Q08648-4) [UniParc]FASTAAdd to basket

Also known as: HE2 beta1

The sequence of this isoform differs from the canonical sequence as follows:
     72-103: VHISHREARGPSFRICVDFLGPRWARGCSTGN → GDVPPGIRNT...KPEMDGRSGI

Show »
Length:133
Mass (Da):14,850
Checksum:iB8D758090CE5651A
GO
Isoform EP2E (identifier: Q08648-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-80: MRQRLLPSVT...QVHISHREAR → MKVFFLFAVL...KPEMDGRSGI
     81-103: Missing.

Show »
Length:80
Mass (Da):9,072
Checksum:iCF2C3F5E0C084019
GO
Isoform EP2F (identifier: Q08648-6)

Sequence is not available
Length:
Mass (Da):

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Isoform EP2C (identifier: Q08648-3)
Sequence conflicti18 – 181L → C in CAG25732 (Ref. 4) Curated
Isoform EP2E (identifier: Q08648-5)
Sequence conflicti31 – 311H → R in AAG21882 (PubMed:11259252).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti77 – 771R → Q.1 Publication
Corresponds to variant rs2853658 [ dbSNP | Ensembl ].
VAR_005269
Natural varianti89 – 891D → G.
Corresponds to variant rs2738035 [ dbSNP | Ensembl ].
VAR_053683

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8080MRQRL…HREAR → MKVFFLFAVLFCLVQTNSGD VPPGIRNTICHMQQGICRLF FCHSGEKKRDICSDPWNRCC VSNTDEEGKEKPEMDGRSGI in isoform EP2E. CuratedVSP_044926Add
BLAST
Alternative sequencei1 – 7171MRQRL…TPPYQ → MKVFFLFAVLFCLVQTNS in isoform EP2B. CuratedVSP_006208Add
BLAST
Alternative sequencei72 – 10332VHISH…CSTGN → EPASDLKVVDCRRSEGFCQE YCNYMETQVGYCSKKKDACC LH in isoform EP2C. 1 PublicationVSP_006209Add
BLAST
Alternative sequencei72 – 10332VHISH…CSTGN → GDVPPGIRNTICRMQQGICR LFFCHSGEKKRDICSDPWNR CCVSNTDEEGKEKPEMDGRS GI in isoform EP2D. 1 PublicationVSP_006210Add
BLAST
Alternative sequencei81 – 10323Missing in isoform EP2E. CuratedVSP_044927Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X67697 mRNA. Translation: CAA47927.1.
AF168616 mRNA. Translation: AAF37186.1.
AF168617 mRNA. Translation: AAF37187.1.
AY005129 Genomic DNA. Translation: AAG21878.1.
AY005129 Genomic DNA. Translation: AAG21879.1.
AY005129 Genomic DNA. Translation: AAG21880.1.
AY005129 Genomic DNA. Translation: AAG21881.1.
AY005129 Genomic DNA. Translation: AAG21882.1.
AY005129 Genomic DNA. Translation: AAG21883.1.
AJ628017 mRNA. Translation: CAF31328.1.
AJ635328 mRNA. Translation: CAG25732.1.
AC130360 Genomic DNA. No translation available.
CCDSiCCDS47774.1. [Q08648-4]
CCDS5966.1. [Q08648-1]
CCDS5967.1. [Q08648-3]
PIRiI37454.
RefSeqiNP_057596.1. NM_016512.3. [Q08648-1]
NP_478107.2. NM_058200.2.
NP_478108.2. NM_058201.2.
NP_478109.1. NM_058202.2.
NP_478110.1. NM_058203.2. [Q08648-3]
NP_478113.2. NM_058206.3. [Q08648-2]
NP_478114.2. NM_058207.2. [Q08648-5]
UniGeneiHs.2717.
Hs.610978.

Genome annotation databases

EnsembliENST00000297498; ENSP00000297498; ENSG00000164871. [Q08648-1]
ENST00000317900; ENSP00000322591; ENSG00000164871. [Q08648-3]
ENST00000458665; ENSP00000398550; ENSG00000164871. [Q08648-5]
ENST00000528168; ENSP00000431230; ENSG00000164871. [Q08648-2]
ENST00000619134; ENSP00000483205; ENSG00000274405. [Q08648-5]
ENST00000622314; ENSP00000481630; ENSG00000274405. [Q08648-2]
GeneIDi10407.
KEGGihsa:10407.
UCSCiuc003wri.4. human. [Q08648-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X67697 mRNA. Translation: CAA47927.1.
AF168616 mRNA. Translation: AAF37186.1.
AF168617 mRNA. Translation: AAF37187.1.
AY005129 Genomic DNA. Translation: AAG21878.1.
AY005129 Genomic DNA. Translation: AAG21879.1.
AY005129 Genomic DNA. Translation: AAG21880.1.
AY005129 Genomic DNA. Translation: AAG21881.1.
AY005129 Genomic DNA. Translation: AAG21882.1.
AY005129 Genomic DNA. Translation: AAG21883.1.
AJ628017 mRNA. Translation: CAF31328.1.
AJ635328 mRNA. Translation: CAG25732.1.
AC130360 Genomic DNA. No translation available.
CCDSiCCDS47774.1. [Q08648-4]
CCDS5966.1. [Q08648-1]
CCDS5967.1. [Q08648-3]
PIRiI37454.
RefSeqiNP_057596.1. NM_016512.3. [Q08648-1]
NP_478107.2. NM_058200.2.
NP_478108.2. NM_058201.2.
NP_478109.1. NM_058202.2.
NP_478110.1. NM_058203.2. [Q08648-3]
NP_478113.2. NM_058206.3. [Q08648-2]
NP_478114.2. NM_058207.2. [Q08648-5]
UniGeneiHs.2717.
Hs.610978.

3D structure databases

ProteinModelPortaliQ08648.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115678. 1 interaction.
IntActiQ08648. 1 interaction.
STRINGi9606.ENSP00000316012.

Protein family/group databases

TCDBi1.C.85.1.5. the pore-forming -defensin (-defensin) family.

Polymorphism and mutation databases

BioMutaiSPAG11B.
DMDMi93141314.

Proteomic databases

PaxDbiQ08648.
PeptideAtlasiQ08648.
PRIDEiQ08648.

Protocols and materials databases

DNASUi10407.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000297498; ENSP00000297498; ENSG00000164871. [Q08648-1]
ENST00000317900; ENSP00000322591; ENSG00000164871. [Q08648-3]
ENST00000458665; ENSP00000398550; ENSG00000164871. [Q08648-5]
ENST00000528168; ENSP00000431230; ENSG00000164871. [Q08648-2]
ENST00000619134; ENSP00000483205; ENSG00000274405. [Q08648-5]
ENST00000622314; ENSP00000481630; ENSG00000274405. [Q08648-2]
GeneIDi10407.
KEGGihsa:10407.
UCSCiuc003wri.4. human. [Q08648-1]

Organism-specific databases

CTDi10407.
GeneCardsiSPAG11B.
HGNCiHGNC:14534. SPAG11B.
MIMi606560. gene.
neXtProtiNX_Q08648.
PharmGKBiPA37894.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JFGU. Eukaryota.
ENOG4111B8J. LUCA.
GeneTreeiENSGT00840000130147.
HOGENOMiHOG000266967.
HOVERGENiHBG073275.
InParanoidiQ08648.
OMAiNCKRSEG.
PhylomeDBiQ08648.

Miscellaneous databases

ChiTaRSiSPAG11B. human.
GeneWikiiSPAG11B.
GenomeRNAii10407.
PROiQ08648.
SOURCEiSearch...

Gene expression databases

BgeeiQ08648.
ExpressionAtlasiQ08648. baseline.
GenevisibleiQ08648. HS.

Family and domain databases

InterProiIPR007988. Sperm_Ag_HE2.
[Graphical view]
PfamiPF05324. Sperm_Ag_HE2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of a novel human sperm antigen (HE2) specifically expressed in the proximal epididymis."
    Osterhoff C., Kirchhoff C., Krull N., Ivell R.
    Biol. Reprod. 50:516-525(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EP2A).
  2. "HE2 beta and HE2 gamma, new members of an epididymis-specific family of androgen-regulated proteins in the human."
    Hamil K.G., Sivashanmugam P., Richardson R.T., Grossman G., Ruben S.M., Mohler J.L., Petrusz P., O'Rand M.G., French F.S., Hall S.H.
    Endocrinology 141:1245-1253(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP2A AND EP2D).
  3. "Organization of the human gene encoding the epididymis-specific EP2 protein variants and its relationship to defensin genes."
    Frohlich O., Po C., Young L.G.
    Biol. Reprod. 64:1072-1079(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS EP2A; EP2B; EP2C; EP2D AND EP2E), VARIANT GLN-77.
  4. "SPAG11/Isoform HE2C, an atypical anionic beta-defensin-like peptide of the proximal human epididymis."
    von Horsten H.H., Derr P., Schaefer B., Kirchhoff C.
    Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EP2C).
  5. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiSG11B_HUMAN
AccessioniPrimary (citable) accession number: Q08648
Secondary accession number(s): E9PFH0
, Q546A0, Q6ZYB2, Q9H4P8, Q9H4P9, Q9H4Q0, Q9H4Q1, Q9H4Q2, Q9NRT3, Q9NRV4, Q9NRV5, Q9NRV6, Q9NRV7, Q9NRV8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: April 18, 2006
Last modified: July 6, 2016
This is version 125 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.