Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q08289 (CACB2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 148. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Voltage-dependent L-type calcium channel subunit beta-2

Short name=CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
Lambert-Eaton myasthenic syndrome antigen B
Short name=MYSB
Gene names
Name:CACNB2
Synonyms:CACNLB2, MYSB
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length660 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Subunit structure

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with CAMK2D By similarity. Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane. Interacts with TMIGD2. Ref.11 Ref.12

Subcellular location

Cell membranesarcolemma; Peripheral membrane protein; Cytoplasmic side By similarity Ref.4.

Tissue specificity

Expressed in all tissues.

Post-translational modification

Regulated through phosphorylation at Thr-554 by CaMK2D By similarity.

Involvement in disease

Brugada syndrome 4 (BRGDA4) [MIM:611876]: A heart disease characterized by the association of Brugada syndrome with shortened QT intervals. Brugada syndrome is a tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs, the individual will faint and may die in a few minutes if the heart is not reset.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.14

Sequence similarities

Belongs to the calcium channel beta subunit family.

Contains 1 SH3 domain.

Sequence caution

The sequence AAB51370.1 differs from that shown. Reason: Frameshift at position 515.

Ontologies

Keywords
   Biological processCalcium transport
Ion transport
Transport
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DiseaseBrugada syndrome
Disease mutation
   DomainSH3 domain
   LigandCalcium
   Molecular functionCalcium channel
Ion channel
Voltage-gated channel
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processaxon guidance

Traceable author statement. Source: Reactome

calcium ion import

Inferred from direct assay PubMed 1309651. Source: BHF-UCL

neuromuscular junction development

Traceable author statement Ref.1. Source: ProtInc

positive regulation of calcium ion transport

Inferred from direct assay PubMed 1309651. Source: BHF-UCL

synaptic transmission

Inferred from electronic annotation. Source: Ensembl

transport

Traceable author statement Ref.1Ref.2. Source: ProtInc

visual perception

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentintegral component of plasma membrane

Non-traceable author statement PubMed 9594024. Source: UniProtKB

sarcolemma

Inferred from electronic annotation. Source: UniProtKB-SubCell

voltage-gated calcium channel complex

Inferred from direct assay PubMed 1309651. Source: BHF-UCL

   Molecular_functioncalcium channel activity

Non-traceable author statement PubMed 9594024. Source: UniProtKB

protein binding

Inferred from physical interaction Ref.11. Source: UniProtKB

voltage-gated calcium channel activity

Inferred from direct assay PubMed 1309651. Source: BHF-UCL

Complete GO annotation...

Alternative products

This entry describes 10 isoforms produced by alternative splicing. [Align] [Select]
Isoform 2d (identifier: Q08289-1)

Also known as: CACNB2d;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2a (identifier: Q08289-2)

Also known as: CACNB2a;

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY
Isoform 2b (identifier: Q08289-3)

Also known as: CACNB2b; 2aN4;

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MLDRRLIAPQTKYIIPG
Isoform 2c (identifier: Q08289-4)

Also known as: CACNB2c; 2aN2;

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQ → MNQGSGLDLLKI
Isoform 2e (identifier: Q08289-5)

Also known as: CACNB2e;

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKNSDIC
Isoform 2f (identifier: Q08289-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → AKQKQKS
Isoform 2g (identifier: Q08289-7)

The sequence of this isoform differs from the canonical sequence as follows:
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → AKQKQKS
Isoform 2h (identifier: Q08289-8)

Also known as: 2cN1;

The sequence of this isoform differs from the canonical sequence as follows:
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → GAKSADEQDQWKTAGLFWRFT
Isoform 2cN2 (identifier: Q08289-9)

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQ → MNQGSGLDLLKI
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → GAKSADEQDQWKTAGLFWRFT
Isoform 2cN4 (identifier: Q08289-10)

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MVQRDMSKSP...DTTSNSFVRQ → MLDRRLIAPQTKYIIPG
     224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → GAKSADEQDQWKTAGLFWRFT

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 660660Voltage-dependent L-type calcium channel subunit beta-2
PRO_0000144051

Regions

Domain114 – 18370SH3

Sites

Site5491Required for CaMK2D-binding By similarity

Amino acid modifications

Modified residue5541Phosphothreonine; by CaMK2D By similarity

Natural variations

Alternative sequence1 – 7171MVQRD…SFVRQ → MQCCGLVHRRRVRVSY in isoform 2a and isoform 2f.
VSP_000627
Alternative sequence1 – 7171MVQRD…SFVRQ → MLDRRLIAPQTKYIIPG in isoform 2b and isoform 2cN4.
VSP_000628
Alternative sequence1 – 7171MVQRD…SFVRQ → MKATWIRLLKRAKGGRLKNS DIC in isoform 2e.
VSP_000629
Alternative sequence1 – 4040MVQRD…GAAAQ → MNQGSGLDLLKI in isoform 2c and isoform 2cN2.
VSP_000626
Alternative sequence224 – 26845AIDID…PFFKK → AKQKQKS in isoform 2f and isoform 2g.
VSP_000630
Alternative sequence224 – 26845AIDID…PFFKK → GAKSADEQDQWKTAGLFWRF T in isoform 2h, isoform 2cN2 and isoform 2cN4.
VSP_000631
Natural variant991A → G in a colorectal cancer sample; somatic mutation. Ref.13
VAR_036350
Natural variant5351S → L in BRGDA4; loss of function. Ref.14
VAR_044041

Experimental info

Sequence conflict561D → N in AAQ97608. Ref.4
Sequence conflict691V → L in AAD33729. Ref.5
Sequence conflict100 – 1012ER → Q in AAD33729. Ref.5
Sequence conflict1221N → D in AAD33729. Ref.5
Sequence conflict3641L → V in AAD33729. Ref.5
Sequence conflict3641L → V in AAD33730. Ref.5
Sequence conflict4061R → T in AAD33729. Ref.5
Sequence conflict4061R → T in AAD33730. Ref.5
Sequence conflict5011D → H in AAD33729. Ref.5
Sequence conflict5011D → H in AAD33730. Ref.5
Sequence conflict5241P → G in AAD33729. Ref.5
Sequence conflict5241P → G in AAD33730. Ref.5
Sequence conflict6241Q → QQ in AAD33729. Ref.5
Sequence conflict6241Q → QQ in AAD33730. Ref.5
Sequence conflict6591R → P in AAB53332. Ref.2
Sequence conflict6591R → P in AAG01473. Ref.3
Sequence conflict6591R → P in AAL16948. Ref.3
Sequence conflict6591R → P in AAL16951. Ref.3
Sequence conflict6591R → P in AAL16950. Ref.3
Sequence conflict6591R → P in AAQ97606. Ref.4
Sequence conflict6591R → P in AAQ97607. Ref.4
Sequence conflict6591R → P in AAQ97608. Ref.4
Sequence conflict6591R → P in AAQ97609. Ref.4
Sequence conflict6591R → P in AAQ97610. Ref.4
Sequence conflict6591R → P in AAL73495. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 2d (CACNB2d) [UniParc].

Last modified April 17, 2007. Version 3.
Checksum: 4A08B141EE66404E

FASTA66073,581
        10         20         30         40         50         60 
MVQRDMSKSP PTAAAAVAQE IQMELLENVA PAGALGAAAQ SYGKGARRKN RFKGSDGSTS 

        70         80         90        100        110        120 
SDTTSNSFVR QGSADSYTSR PSDSDVSLEE DREAVRREAE RQAQAQLEKA KTKPVAFAVR 

       130        140        150        160        170        180 
TNVSYSAAHE DDVPVPGMAI SFEAKDFLHV KEKFNNDWWI GRLVKEGCEI GFIPSPVKLE 

       190        200        210        220        230        240 
NMRLQHEQRA KQGKFYSSKS GGNSSSSLGD IVPSSRKSTP PSSAIDIDAT GLDAEENDIP 

       250        260        270        280        290        300 
ANHRSPKPSA NSVTSPHSKE KRMPFFKKTE HTPPYDVVPS MRPVVLVGPS LKGYEVTDMM 

       310        320        330        340        350        360 
QKALFDFLKH RFEGRISITR VTADISLAKR SVLNNPSKHA IIERSNTRSS LAEVQSEIER 

       370        380        390        400        410        420 
IFELARTLQL VVLDADTINH PAQLSKTSLA PIIVYVKISS PKVLQRLIKS RGKSQAKHLN 

       430        440        450        460        470        480 
VQMVAADKLA QCPPELFDVI LDENQLEDAC EHLADYLEAY WKATHPPSSS LPNPLLSRTL 

       490        500        510        520        530        540 
ATSSLPLSPT LASNSQGSQG DQRTDRSAPI RSASQAEEEP SVEPVKKSQH RSSSSAPHHN 

       550        560        570        580        590        600 
HRSGTSRGLS RQETFDSETQ ESRDSAYVEP KEDYSHDHVD HYASHRDHNH RDETHGSSDH 

       610        620        630        640        650        660 
RHRESRHRSR DVDREQDHNE CNKQRSRHKS KDRYCEKDGE VISKKRNEAG EWNRDVYIRQ 

« Hide

Isoform 2a (CACNB2a) [UniParc].

Checksum: 710A5E734B7442DD
Show »

FASTA60568,142
Isoform 2b (CACNB2b) (2aN4) [UniParc].

Checksum: F4A4A1BAE6A105F0
Show »

FASTA60668,164
Isoform 2c (CACNB2c) (2aN2) [UniParc].

Checksum: FBD00FB30E47E5FB
Show »

FASTA63270,832
Isoform 2e (CACNB2e) [UniParc].

Checksum: 1D60077179676927
Show »

FASTA61268,838
Isoform 2f [UniParc].

Checksum: CBCD97B7822B92E6
Show »

FASTA56764,010
Isoform 2g [UniParc].

Checksum: 9FBABEC5BE5DD074
Show »

FASTA62269,449
Isoform 2h (2cN1) [UniParc].

Checksum: 71521EDDD736A9CF
Show »

FASTA63671,075
Isoform 2cN2 [UniParc].

Checksum: 45DCA4A5AF7ACAF4
Show »

FASTA60868,326
Isoform 2cN4 [UniParc].

Checksum: 4AC64252EDD46ABB
Show »

FASTA58265,658

References

« Hide 'large scale' references
[1]"Cloning and characterization of a Lambert-Eaton myasthenic syndrome antigen."
Rosenfeld M.R., Wong E., Dalmau J., Manley G., Posner J.B., Sher E., Furneaux H.M.
Ann. Neurol. 33:113-120(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2A; 2G AND 2H).
Tissue: Fetal brain.
[2]"Assignment of human genes for beta 2 and beta 4 subunits of voltage-dependent Ca2+ channels to chromosomes 10p12 and 2q22-q23."
Taviaux S., Williams M.E., Harpold M.M., Nargeot J., Lory P.
Hum. Genet. 100:151-154(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2A).
Tissue: Brain.
[3]"Novel functional properties of Ca(2+) channel beta subunits revealed by their expression in adult rat heart cells."
Colecraft H.M., Alseikhan B., Takahashi S.X., Chaudhuri D., Mittman S., Yegnasubramanian V., Alvania R.S., Johns D.C., Marban E., Yue D.T.
J. Physiol. (Lond.) 541:435-452(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2A; 2B; 2C; 2D AND 2E).
[4]"Molecular heterogeneity of calcium channel beta-subunits in canine and human heart: evidence for differential subcellular localization."
Foell J.D., Balijepalli R.C., Delisle B.P., Yunker A.M.R., Robia S.L., Walker J.W., McEnery M.W., January C.T., Kamp T.J.
Physiol. Genomics 17:183-200(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2B; 2C; 2H; 2CN2 AND 2CN4), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION.
Tissue: Heart.
[5]"Cooperative effects of alpha2delta and beta2a subunits on surface expression of calcium channel alpha1c subunits."
Mikala G., Yamaguchi H., Schwartz A.
Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2A AND 2D).
[6]"The beta 2 subunit of the voltage-dependent calcium channel (CACNB2): genomic structure and mutational analysis as a candidate gene for ARVD6."
Li D., Roberts R.
Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2A).
[7]"Human jejunum voltage-gated calcium channel subunits."
Lyford G.L., Strege P., Shepard A., Miller S., Rae J., Gibbons S., Szurszewski J., Farrugia G.
Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2F).
Tissue: Jejunum.
[8]"The DNA sequence and comparative analysis of human chromosome 10."
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. expand/collapse author list , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
[11]"Dominant negative suppression of Rad leads to QT prolongation and causes ventricular arrhythmias via modulation of L-type Ca2+ channels in the heart."
Yada H., Murata M., Shimoda K., Yuasa S., Kawaguchi H., Ieda M., Adachi T., Murata M., Ogawa S., Fukuda K.
Circ. Res. 101:69-77(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH RRAD.
[12]"Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis."
Rahimi N., Rezazadeh K., Mahoney J.E., Hartsough E., Meyer R.D.
Mol. Biol. Cell 23:1646-1656(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH TMIGD2.
[13]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT [LARGE SCALE ANALYSIS] GLY-99.
[14]"Loss-of-function mutations in the cardiac calcium channel underlie a new clinical entity characterized by ST-segment elevation, short QT intervals, and sudden cardiac death."
Antzelevitch C., Pollevick G.D., Cordeiro J.M., Casis O., Sanguinetti M.C., Aizawa Y., Guerchicoff A., Pfeiffer R., Oliva A., Wollnik B., Gelber P., Bonaros E.P. Jr., Burashnikov E., Wu Y., Sargent J.D., Schickel S., Oberheiden R., Bhatia A. expand/collapse author list , Hsu L.F., Haissaguerre M., Schimpf R., Borggrefe M., Wolpert C.
Circulation 115:442-449(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT BRGDA4 LEU-535, CHARACTERIZATION OF VARIANT BRGDA4 LEU-535.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
S60415 mRNA. Translation: AAB51370.1. Frameshift.
U95019 mRNA. Translation: AAB53332.1.
AF423189 mRNA. Translation: AAL16948.1.
AF423190 mRNA. Translation: AAL16949.1.
AF423191 mRNA. Translation: AAL16950.1.
AF423192 mRNA. Translation: AAL16951.1.
AF285239 mRNA. Translation: AAG01473.2.
AY393858 mRNA. Translation: AAQ97606.1.
AY393859 mRNA. Translation: AAQ97607.1.
AY393860 mRNA. Translation: AAQ97608.1.
AY393861 mRNA. Translation: AAQ97609.1.
AY393862 mRNA. Translation: AAQ97610.1.
AF137376 mRNA. Translation: AAD33729.1.
AF137377 mRNA. Translation: AAD33730.1.
AY027898 expand/collapse EMBL AC list , AY027893, AY027894, AY027895, AY027896, AY027897 Genomic DNA. Translation: AAK16994.1.
AF465485 mRNA. Translation: AAL73495.1.
AL360231 expand/collapse EMBL AC list , AL139814, AL450364, AL450384 Genomic DNA. Translation: CAH70125.1.
AL139814 expand/collapse EMBL AC list , AL360231, AL450364, AL450384 Genomic DNA. Translation: CAH71352.1.
AL450384 expand/collapse EMBL AC list , AL139814, AL360231, AL450364 Genomic DNA. Translation: CAH73209.1.
AL450364 expand/collapse EMBL AC list , AL139814, AL360231, AL450384 Genomic DNA. Translation: CAI14734.1.
AL390783 expand/collapse EMBL AC list , AL139814, AL450364, AL450384 Genomic DNA. Translation: CAH70065.1.
AL390783 expand/collapse EMBL AC list , AL139814, AL450364, AL450384 Genomic DNA. Translation: CAH70066.1.
AL360231 expand/collapse EMBL AC list , AL139814, AL450364, AL450384 Genomic DNA. Translation: CAH70126.1.
AL139814 expand/collapse EMBL AC list , AL390783, AL450364, AL450384 Genomic DNA. Translation: CAH71350.1.
AL139814 expand/collapse EMBL AC list , AL390783, AL450364, AL450384 Genomic DNA. Translation: CAH71351.1.
AL139814 expand/collapse EMBL AC list , AL360231, AL450364, AL450384 Genomic DNA. Translation: CAH71353.1.
AL450384 expand/collapse EMBL AC list , AL139814, AL390783, AL450364 Genomic DNA. Translation: CAH73207.1.
AL450384 expand/collapse EMBL AC list , AL139814, AL390783, AL450364 Genomic DNA. Translation: CAH73208.1.
AL450384 expand/collapse EMBL AC list , AL139814, AL360231, AL450364 Genomic DNA. Translation: CAH73210.1.
AL450364 expand/collapse EMBL AC list , AL139814, AL390783, AL450384 Genomic DNA. Translation: CAI14732.1.
AL450364 expand/collapse EMBL AC list , AL139814, AL390783, AL450384 Genomic DNA. Translation: CAI14733.1.
AL450364 expand/collapse EMBL AC list , AL139814, AL360231, AL450384 Genomic DNA. Translation: CAI14735.1.
AL390783 expand/collapse EMBL AC list , AL139814, AL450364, AL450384 Genomic DNA. Translation: CAO03475.1.
AL450384 expand/collapse EMBL AC list , AL139814, AL360231, AL450364 Genomic DNA. Translation: CAO03513.1.
AL450384 expand/collapse EMBL AC list , AL139814, AL360231, AL450364 Genomic DNA. Translation: CAO03515.1.
AL450384 expand/collapse EMBL AC list , AL139814, AL390783, AL450364 Genomic DNA. Translation: CAO03516.1.
AL139814 expand/collapse EMBL AC list , AL360231, AL450364, AL450384 Genomic DNA. Translation: CAO03603.1.
AL139814 expand/collapse EMBL AC list , AL360231, AL450364, AL450384 Genomic DNA. Translation: CAO03605.1.
AL139814 expand/collapse EMBL AC list , AL390783, AL450364, AL450384 Genomic DNA. Translation: CAO03606.1.
AL450364 expand/collapse EMBL AC list , AL139814, AL360231, AL450384 Genomic DNA. Translation: CAO03634.1.
AL450364 expand/collapse EMBL AC list , AL139814, AL360231, AL450384 Genomic DNA. Translation: CAO03636.1.
AL450364 expand/collapse EMBL AC list , AL139814, AL390783, AL450384 Genomic DNA. Translation: CAO03637.1.
AL360231 expand/collapse EMBL AC list , AL139814, AL450364, AL450384 Genomic DNA. Translation: CAO03672.1.
AL360231 expand/collapse EMBL AC list , AL139814, AL450364, AL450384 Genomic DNA. Translation: CAO03674.1.
AL353603 Genomic DNA. No translation available.
CH471072 Genomic DNA. Translation: EAW86196.1.
CH471072 Genomic DNA. Translation: EAW86197.1.
BC136409 mRNA. Translation: AAI36410.1.
CCDSCCDS41493.1. [Q08289-9]
CCDS41494.1. [Q08289-3]
CCDS7125.1. [Q08289-1]
CCDS7126.1. [Q08289-8]
CCDS7127.1. [Q08289-4]
CCDS7128.1. [Q08289-2]
CCDS7129.1. [Q08289-5]
PIRA48895.
RefSeqNP_000715.2. NM_000724.3. [Q08289-2]
NP_963864.1. NM_201570.2. [Q08289-5]
NP_963865.2. NM_201571.3. [Q08289-4]
NP_963866.2. NM_201572.3. [Q08289-9]
NP_963884.2. NM_201590.2. [Q08289-3]
NP_963887.2. NM_201593.2. [Q08289-7]
NP_963890.2. NM_201596.2. [Q08289-1]
NP_963891.1. NM_201597.2. [Q08289-8]
UniGeneHs.59093.

3D structure databases

ProteinModelPortalQ08289.
SMRQ08289. Positions 90-216, 262-470.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ08289. 1 interaction.

Chemistry

ChEMBLCHEMBL2363032.
DrugBankDB00653. Magnesium Sulfate.
DB00661. Verapamil.

Protein family/group databases

TCDB8.A.22.1.2. the ca(2+) channel auxiliary subunit types 1-4 (cca-) family.

PTM databases

PhosphoSiteQ08289.

Polymorphism databases

DMDM145559447.

Proteomic databases

MaxQBQ08289.
PaxDbQ08289.
PRIDEQ08289.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000282343; ENSP00000282343; ENSG00000165995. [Q08289-4]
ENST00000324631; ENSP00000320025; ENSG00000165995. [Q08289-1]
ENST00000352115; ENSP00000344474; ENSG00000165995. [Q08289-8]
ENST00000377315; ENSP00000366532; ENSG00000165995. [Q08289-5]
ENST00000377319; ENSP00000366536; ENSG00000165995. [Q08289-6]
ENST00000377329; ENSP00000366546; ENSG00000165995. [Q08289-3]
ENST00000377331; ENSP00000366548; ENSG00000165995. [Q08289-9]
ENST00000396576; ENSP00000379821; ENSG00000165995. [Q08289-2]
GeneID783.
KEGGhsa:783.
UCSCuc001ipr.2. human. [Q08289-1]
uc001ips.2. human. [Q08289-8]
uc001ipt.2. human. [Q08289-7]
uc001ipu.3. human. [Q08289-4]
uc001ipv.3. human.
uc001ipw.2. human. [Q08289-6]
uc001ipx.2. human. [Q08289-2]
uc001ipy.2. human. [Q08289-3]

Organism-specific databases

CTD783.
GeneCardsGC10P018469.
GeneReviewsCACNB2.
HGNCHGNC:1402. CACNB2.
HPAHPA035326.
MIM600003. gene.
611876. phenotype.
neXtProtNX_Q08289.
Orphanet130. Brugada syndrome.
PharmGKBPA88.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG326500.
HOVERGENHBG050765.
InParanoidQ08289.
KOK04863.
OMADSAYVEP.
OrthoDBEOG7966G4.
PhylomeDBQ08289.
TreeFamTF316195.

Enzyme and pathway databases

ReactomeREACT_111045. Developmental Biology.
REACT_111217. Metabolism.
REACT_13685. Neuronal System.
SignaLinkQ08289.

Gene expression databases

ArrayExpressQ08289.
BgeeQ08289.
GenevestigatorQ08289.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERPTHR11824. PTHR11824. 1 hit.
PfamPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSPR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTSM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMSSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEPS50002. SH3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCACNB2. human.
GeneWikiCACNB2.
GenomeRNAi783.
NextBio3172.
PROQ08289.
SOURCESearch...

Entry information

Entry nameCACB2_HUMAN
AccessionPrimary (citable) accession number: Q08289
Secondary accession number(s): A6PVM5 expand/collapse secondary AC list , A6PVM7, A6PVM8, O00304, Q5QJ99, Q5QJA0, Q5VVG9, Q5VVH0, Q5VWV6, Q6TME1, Q6TME2, Q6TME3, Q8WX81, Q96NZ3, Q96NZ4, Q96NZ5, Q9BWU2, Q9HD32, Q9Y340, Q9Y341
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: April 17, 2007
Last modified: July 9, 2014
This is version 148 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 10

Human chromosome 10: entries, gene names and cross-references to MIM