Q08289 (CACB2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 122.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Voltage-dependent L-type calcium channel subunit beta-2 Short name=CAB2 Alternative name(s): Calcium channel voltage-dependent subunit beta 2 Lambert-Eaton myasthenic syndrome antigen B Short name=MYSB | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 660 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. |
| Subunit structure | The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with CAMK2D By similarity. Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane. Ref.10 |
| Subcellular location | Cell membrane › sarcolemma; Peripheral membrane protein; Cytoplasmic side By similarity. |
| Tissue specificity | Expressed in all tissues. |
| Post-translational modification | Regulated through phosphorylation at Thr-554 by CaMK2D By similarity. |
| Involvement in disease | Defects in CACNB2 are the cause of Brugada syndrome type 4 (BRS4) [MIM:611876]. BRS4 is a heart disease characterized by the association of Brugada syndrome with shortened QT intervals. Brugada syndrome is a tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs (called ventricular fibrillation), the individual will faint and may die in a few minutes if the heart is not reset. Ref.12 |
| Sequence similarities | Belongs to the calcium channel beta subunit family. Contains 1 SH3 domain. |
| Sequence caution | The sequence AAB51370.1 differs from that shown. Reason: Frameshift at position 515. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Calcium transport Ion transport Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Brugada syndrome Disease mutation |
| Domain | SH3 domain |
| Ligand | Calcium |
| Molecular function | Calcium channel Ionic channel Voltage-gated channel |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | axon guidance Traceable author statement. Source: Reactome neuromuscular junction developmentTraceable author statement. Source: ProtInc |
| Cellular component | integral to plasma membrane Non-traceable author statement. Source: UniProtKB sarcolemmaInferred from electronic annotation. Source: UniProtKB-SubCell voltage-gated calcium channel complexTraceable author statement. Source: ProtInc |
| Molecular function | protein binding Inferred from physical interaction Ref.10. Source: UniProtKB voltage-gated calcium channel activityTraceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2d (identifier: Q08289-1) Also known as: CACNB2d; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2a (identifier: Q08289-2) Also known as: CACNB2a; The sequence of this isoform differs from the canonical sequence as follows: 1-71: MVQRDMSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY | ||||||
| Isoform 2b (identifier: Q08289-3) Also known as: CACNB2b; The sequence of this isoform differs from the canonical sequence as follows: 1-71: MVQRDMSKSP...DTTSNSFVRQ → MLDRRLIAPQTKYIIPG | ||||||
| Isoform 2c (identifier: Q08289-4) Also known as: CACNB2c; The sequence of this isoform differs from the canonical sequence as follows: 1-40: MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQ → MNQGSGLDLLKI | ||||||
| Isoform 2e (identifier: Q08289-5) Also known as: CACNB2e; The sequence of this isoform differs from the canonical sequence as follows: 1-71: MVQRDMSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGGRLKNSDIC | ||||||
| Isoform 2f (identifier: Q08289-6) The sequence of this isoform differs from the canonical sequence as follows: 1-71: MVQRDMSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSY 224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → AKQKQKS | ||||||
| Isoform 2g (identifier: Q08289-7) The sequence of this isoform differs from the canonical sequence as follows: 224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → AKQKQKS | ||||||
| Isoform 2h (identifier: Q08289-8) The sequence of this isoform differs from the canonical sequence as follows: 224-268: AIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → GAKSADEQDQWKTAGLFWRFT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 660 | 660 | Voltage-dependent L-type calcium channel subunit beta-2 | PRO_0000144051 | |||||
Regions | |||||||||
| Domain | 114 – 183 | 70 | SH3 | ||||||
Sites | |||||||||
| Site | 549 | 1 | Required for CaMK2D-binding By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 554 | 1 | Phosphothreonine; by CaMK2D By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 71 | 71 | MVQRD…SFVRQ → MQCCGLVHRRRVRVSY in isoform 2a and isoform 2f. | VSP_000627 | |||||
| Alternative sequence | 1 – 71 | 71 | MVQRD…SFVRQ → MLDRRLIAPQTKYIIPG in isoform 2b. | VSP_000628 | |||||
| Alternative sequence | 1 – 71 | 71 | MVQRD…SFVRQ → MKATWIRLLKRAKGGRLKNS DIC in isoform 2e. | VSP_000629 | |||||
| Alternative sequence | 1 – 40 | 40 | MVQRD…GAAAQ → MNQGSGLDLLKI in isoform 2c. | VSP_000626 | |||||
| Alternative sequence | 224 – 268 | 45 | AIDID…PFFKK → AKQKQKS in isoform 2f and isoform 2g. | VSP_000630 | |||||
| Alternative sequence | 224 – 268 | 45 | AIDID…PFFKK → GAKSADEQDQWKTAGLFWRF T in isoform 2h. | VSP_000631 | |||||
| Natural variant | 99 | 1 | A → G in a colorectal cancer sample; somatic mutation. Ref.11 | VAR_036350 | |||||
| Natural variant | 535 | 1 | S → L in BRS4; loss of function. Ref.12 | VAR_044041 | |||||
Experimental info | |||||||||
| Sequence conflict | 69 | 1 | V → L in AAD33729. Ref.3 | ||||||
| Sequence conflict | 100 – 101 | 2 | ER → Q in AAD33729. Ref.3 | ||||||
| Sequence conflict | 122 | 1 | N → D in AAD33729. Ref.3 | ||||||
| Sequence conflict | 364 | 1 | L → V in AAD33729. Ref.3 | ||||||
| Sequence conflict | 364 | 1 | L → V in AAD33730. Ref.3 | ||||||
| Sequence conflict | 406 | 1 | R → T in AAD33729. Ref.3 | ||||||
| Sequence conflict | 406 | 1 | R → T in AAD33730. Ref.3 | ||||||
| Sequence conflict | 501 | 1 | D → H in AAD33729. Ref.3 | ||||||
| Sequence conflict | 501 | 1 | D → H in AAD33730. Ref.3 | ||||||
| Sequence conflict | 524 | 1 | P → G in AAD33729. Ref.3 | ||||||
| Sequence conflict | 524 | 1 | P → G in AAD33730. Ref.3 | ||||||
| Sequence conflict | 624 | 1 | Q → QQ in AAD33729. Ref.3 | ||||||
| Sequence conflict | 624 | 1 | Q → QQ in AAD33730. Ref.3 | ||||||
| Sequence conflict | 659 | 1 | R → P in AAB53332. Ref.2 | ||||||
| Sequence conflict | 659 | 1 | R → P in AAG01473. Ref.5 | ||||||
| Sequence conflict | 659 | 1 | R → P in AAL16948. Ref.5 | ||||||
| Sequence conflict | 659 | 1 | R → P in AAL16951. Ref.5 | ||||||
| Sequence conflict | 659 | 1 | R → P in AAL16950. Ref.5 | ||||||
| Sequence conflict | 659 | 1 | R → P in AAL73495. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a Lambert-Eaton myasthenic syndrome antigen." Rosenfeld M.R., Wong E., Dalmau J., Manley G., Posner J.B., Sher E., Furneaux H.M. Ann. Neurol. 33:113-120(1993) [PubMed: 8494331] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2A; 2G AND 2H). Tissue: Fetal brain. |
| [2] | "Assignment of human genes for beta 2 and beta 4 subunits of voltage-dependent Ca2+ channels to chromosomes 10p12 and 2q22-q23." Taviaux S., Williams M.E., Harpold M.M., Nargeot J., Lory P. Hum. Genet. 100:151-154(1997) [PubMed: 9254841] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2A). Tissue: Brain. |
| [3] | "Cooperative effects of alpha2delta and beta2a subunits on surface expression of calcium channel alpha1c subunits." Mikala G., Yamaguchi H., Schwartz A. Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2A AND 2D). |
| [4] | "The beta 2 subunit of the voltage-dependent calcium channel (CACNB2): genomic structure and mutational analysis as a candidate gene for ARVD6." Li D., Roberts R. Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2A). |
| [5] | "Novel functional properties of Ca2+ channel beta subunits revealed by their expression in adult heart cells." Colecraft H.M., Mittman S., Takahashi S., Yue D.T. Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2A; 2B; 2C; 2D AND 2E). |
| [6] | "Human jejunum voltage-gated calcium channel subunits." Lyford G.L., Strege P., Shepard A., Miller S., Rae J., Gibbons S., Szurszewski J., Farrugia G. Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2F). Tissue: Jejunum. |
| [7] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [10] | "Dominant negative suppression of Rad leads to QT prolongation and causes ventricular arrhythmias via modulation of L-type Ca2+ channels in the heart." Yada H., Murata M., Shimoda K., Yuasa S., Kawaguchi H., Ieda M., Adachi T., Murata M., Ogawa S., Fukuda K. Circ. Res. 101:69-77(2007) [PubMed: 17525370] [Abstract] Cited for: INTERACTION WITH RRAD. |
| [11] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] GLY-99. |
| [12] | "Loss-of-function mutations in the cardiac calcium channel underlie a new clinical entity characterized by ST-segment elevation, short QT intervals, and sudden cardiac death." Antzelevitch C., Pollevick G.D., Cordeiro J.M., Casis O., Sanguinetti M.C., Aizawa Y., Guerchicoff A., Pfeiffer R., Oliva A., Wollnik B., Gelber P., Bonaros E.P. Jr., Burashnikov E., Wu Y., Sargent J.D., Schickel S., Oberheiden R., Bhatia A. Wolpert C.Circulation 115:442-449(2007) [PubMed: 17224476] [Abstract] Cited for: VARIANT BRS4 LEU-535, CHARACTERIZATION OF VARIANT BRS4 LEU-535. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | S60415 mRNA. Translation: AAB51370.1. Frameshift. U95019 mRNA. Translation: AAB53332.1. AF137376 mRNA. Translation: AAD33729.1. AF137377 mRNA. Translation: AAD33730.1. AY027898 AY027897 Genomic DNA. Translation: AAK16994.1.AF423189 mRNA. Translation: AAL16948.1. AF423190 mRNA. Translation: AAL16949.1. AF423191 mRNA. Translation: AAL16950.1. AF423192 mRNA. Translation: AAL16951.1. AF285239 mRNA. Translation: AAG01473.2. AF465485 mRNA. Translation: AAL73495.1. AL360231 AL450384 Genomic DNA. Translation: CAH70125.1.AL139814 AL450384 Genomic DNA. Translation: CAH71352.1.AL450384 AL450364 Genomic DNA. Translation: CAH73209.1.AL450364 AL450384 Genomic DNA. Translation: CAI14734.1.AL390783 AL450384 Genomic DNA. Translation: CAH70065.1.AL390783 AL450384 Genomic DNA. Translation: CAH70066.1.AL360231 AL450384 Genomic DNA. Translation: CAH70126.1.AL139814 AL450384 Genomic DNA. Translation: CAH71350.1.AL139814 AL450384 Genomic DNA. Translation: CAH71351.1.AL139814 AL450384 Genomic DNA. Translation: CAH71353.1.AL450384 AL450364 Genomic DNA. Translation: CAH73207.1.AL450384 AL450364 Genomic DNA. Translation: CAH73208.1.AL450384 AL450364 Genomic DNA. Translation: CAH73210.1.AL450364 AL450384 Genomic DNA. Translation: CAI14732.1.AL450364 AL450384 Genomic DNA. Translation: CAI14733.1.AL450364 AL450384 Genomic DNA. Translation: CAI14735.1.AL390783 AL450384 Genomic DNA. Translation: CAO03475.1.AL450384 AL450364 Genomic DNA. Translation: CAO03513.1.AL450384 AL450364 Genomic DNA. Translation: CAO03516.1.AL139814 AL450384 Genomic DNA. Translation: CAO03603.1.AL139814 AL450384 Genomic DNA. Translation: CAO03606.1.AL450364 AL450384 Genomic DNA. Translation: CAO03634.1.AL450364 AL450384 Genomic DNA. Translation: CAO03637.1.AL360231 AL450384 Genomic DNA. Translation: CAO03672.1.CH471072 Genomic DNA. Translation: EAW86196.1. CH471072 Genomic DNA. Translation: EAW86197.1. BC136409 mRNA. Translation: AAI36410.1. |
| IPI | IPI00000867. IPI00218399. IPI00218400. IPI00218401. IPI00218402. IPI00218404. IPI00218405. IPI00409678. |
| PIR | A48895. |
| RefSeq | NP_000715.2. NM_000724.3. NP_963864.1. NM_201570.2. NP_963865.2. NM_201571.3. NP_963884.2. NM_201590.2. NP_963887.2. NM_201593.2. NP_963890.2. NM_201596.2. NP_963891.1. NM_201597.2. |
| UniGene | Hs.59093. |
3D structure databases | |
| ProteinModelPortal | Q08289. |
| SMR | Q08289. Positions 88-470. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q08289. 1 interaction. |
| STRING | Q08289. |
Protein family/group databases | |
| TCDB | 8.A.22.2.1. Ca2+ channel auxiliary subunit beta types 1-4 (CCA-beta) family. |
PTM databases | |
| PhosphoSite | Q08289. |
Polymorphism databases | |
| DMDM | 145559447. |
Proteomic databases | |
| PRIDE | Q08289. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000324631; ENSP00000320025; ENSG00000165995. |
| GeneID | 783. |
| KEGG | hsa:783. |
| UCSC | uc001ipr.2. human. uc001ips.2. human. uc001ipt.2. human. uc001ipy.2. human. |
Organism-specific databases | |
| CTD | 783. |
| GeneCards | GC10P018469. |
| HGNC | HGNC:1402. CACNB2. |
| HPA | HPA035326. |
| MIM | 600003. gene. 611876. phenotype. |
| neXtProt | NX_Q08289. |
| Orphanet | 130. Brugada syndrome. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG09479. |
| HOVERGEN | HBG050765. |
| InParanoid | Q08289. |
| OMA | RHKSKDR. |
| OrthoDB | EOG4WQ12J. |
| PhylomeDB | Q08289. |
Enzyme and pathway databases | |
| Reactome | REACT_111045. Developmental Biology. REACT_111217. Metabolism. REACT_13685. Neuronal System. |
Gene expression databases | |
| ArrayExpress | Q08289. |
| Bgee | Q08289. |
| Genevestigator | Q08289. |
| GermOnline | ENSG00000165995. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008144. Guanylate_kin. IPR008145. Guanylate_kin/L-typ_Ca_channel. IPR001452. SH3_domain. IPR005444. VDCC_L_b2su. IPR000584. VDCC_L_bsu. [Graphical view] |
| KO | K04863. |
| PANTHER | PTHR11824. Ca_channel_B. 1 hit. |
| Pfam | PF00625. Guanylate_kin. 1 hit. PF12052. VGCC_beta4Aa_N. 1 hit. [Graphical view] |
| PRINTS | PR01626. LCACHANNELB. PR01628. LCACHANNELB2. |
| SMART | SM00072. GuKc. 1 hit. SM00326. SH3. 1 hit. [Graphical view] |
| SUPFAM | SSF50044. SH3. 1 hit. |
| PROSITE | PS50002. SH3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00653. Magnesium Sulfate. DB00661. Verapamil. |
| NextBio | 3172. |
| SOURCE | Search... |
Entry information
| Entry name | CACB2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q08289 Secondary accession number(s): A6PVM5 Q9Y341 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with