SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q08050

- FOXM1_HUMAN

UniProt

Q08050 - FOXM1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Forkhead box protein M1
Gene
FOXM1, FKHL16, HFH11, MPP2, WIN
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.3 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi235 – 32793Fork-head
Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB
  2. DNA binding, bending Source: RefGenome
  3. RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity Source: RefGenome
  4. double-stranded DNA binding Source: RefGenome
  5. protein binding Source: IntAct
  6. protein kinase binding Source: UniProtKB
  7. sequence-specific DNA binding Source: InterPro
  8. sequence-specific DNA binding transcription factor activity Source: UniProtKB
  9. transcription factor binding Source: RefGenome
  10. transcription regulatory region DNA binding Source: Ensembl

GO - Biological processi

  1. DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator Source: UniProtKB
  2. DNA repair Source: UniProtKB-KW
  3. G2/M transition of mitotic cell cycle Source: UniProtKB
  4. cell cycle Source: UniProtKB
  5. liver development Source: RefGenome
  6. mitotic cell cycle Source: Reactome
  7. negative regulation of cell aging Source: UniProtKB
  8. negative regulation of stress-activated MAPK cascade Source: BHF-UCL
  9. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  10. negative regulation of transcription, DNA-templated Source: BHF-UCL
  11. pattern specification process Source: RefGenome
  12. positive regulation of cell proliferation Source: BHF-UCL
  13. positive regulation of double-strand break repair Source: UniProtKB
  14. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  15. positive regulation of transcription, DNA-templated Source: UniProtKB
  16. regulation of Ras protein signal transduction Source: BHF-UCL
  17. regulation of cell cycle Source: Reactome
  18. regulation of cell cycle arrest Source: BHF-UCL
  19. regulation of cell growth Source: UniProtKB
  20. regulation of cell proliferation Source: UniProtKB
  21. regulation of reactive oxygen species metabolic process Source: BHF-UCL
  22. regulation of sequence-specific DNA binding transcription factor activity Source: RefGenome
  23. regulation of transcription, DNA-templated Source: GOC
  24. tissue development Source: RefGenome
  25. transcription from RNA polymerase II promoter Source: GOC
  26. vasculogenesis Source: RefGenome
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Cell cycle, DNA damage, DNA repair, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiREACT_1006. Polo-like kinase mediated events.
REACT_1857. Cyclin A/B1 associated events during G2/M transition.

Names & Taxonomyi

Protein namesi
Recommended name:
Forkhead box protein M1
Alternative name(s):
Forkhead-related protein FKHL16
Hepatocyte nuclear factor 3 forkhead homolog 11
Short name:
HFH-11
Short name:
HNF-3/fork-head homolog 11
M-phase phosphoprotein 2
MPM-2 reactive phosphoprotein 2
Transcription factor Trident
Winged-helix factor from INS-1 cells
Gene namesi
Name:FOXM1
Synonyms:FKHL16, HFH11, MPP2, WIN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:3818. FOXM1.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. nucleoplasm Source: Reactome
  3. nucleus Source: HPA
  4. transcription factor complex Source: RefGenome
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi611 – 6111T → A: Prevents phosphorylation by CDK1 and subsequent binding of POLO box domains of PLK1; when associated with A-693. 1 Publication
Mutagenesisi693 – 6931S → A: Prevents phosphorylation by CDK1 and subsequent binding of POLO box domains of PLK1; when associated with A-611. 1 Publication
Mutagenesisi730 – 7301S → A: Prevents phosphorylation by PLK1 and impairs transcription activity; when associated with A-739. 1 Publication
Mutagenesisi739 – 7391S → A: Prevents phosphorylation by PLK1 and impairs transcription activity; when associated with A-730. 1 Publication

Organism-specific databases

PharmGKBiPA28236.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 763763Forkhead box protein M1
PRO_0000091863Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei331 – 3311Phosphoserine1 Publication
Modified residuei376 – 3761Phosphoserine; by CHEK21 Publication
Modified residuei611 – 6111Phosphothreonine; by CDK11 Publication
Modified residuei620 – 6201Phosphothreonine1 Publication
Modified residuei627 – 6271Phosphothreonine1 Publication
Modified residuei662 – 6621Phosphothreonine Inferred
Modified residuei693 – 6931Phosphoserine; by CDK11 Publication
Modified residuei730 – 7301Phosphoserine; by PLK12 Publications
Modified residuei739 – 7391Phosphoserine; by PLK12 Publications

Post-translational modificationi

Phosphorylated in M (mitotic) phase. Phosphorylation by the checkpoint kinase CHEK2 in response to DNA damage increases the FOXM1 protein stability probably stimulating the transcription of genes involved in DNA repair. Phosphorylated by CDK1 in late S and G2 phases, creating docking sites for the POLO box domains of PLK1. Subsequently, PLK1 binds and phosphorylates FOXM1, leading to activation of transcriptional activity and subsequent enhanced expression of key mitotic regulators.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ08050.
PaxDbiQ08050.
PRIDEiQ08050.

PTM databases

PhosphoSiteiQ08050.

Expressioni

Tissue specificityi

Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Isoform 2 is highly expressed in testis.

Developmental stagei

Embryonic expression pattern: liver, lung, intestine, kidney, urinary tract; adult expression pattern: intestine, colon, testis and thymus.

Inductioni

Induced during liver regeneration and oxidative stress.

Gene expression databases

ArrayExpressiQ08050.
BgeeiQ08050.
CleanExiHS_FOXM1.
HS_MPP2.
GenevestigatoriQ08050.

Organism-specific databases

HPAiCAB017832.
HPA029974.
HPA029975.
HPA029976.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CCNE1P248642EBI-866480,EBI-519526
CDK6Q005342EBI-866499,EBI-295663
CTNNB1P3522216EBI-866480,EBI-491549
E7P031293EBI-866499,EBI-866453From a different organism.
FOXO3O435242EBI-866480,EBI-1644164

Protein-protein interaction databases

BioGridi108594. 26 interactions.
DIPiDIP-36754N.
IntActiQ08050. 13 interactions.
MINTiMINT-107757.
STRINGi9606.ENSP00000342307.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi241 – 25010
Beta strandi255 – 2573
Helixi259 – 26911
Helixi272 – 2754
Helixi281 – 29111
Beta strandi295 – 2995
Beta strandi306 – 3105
Turni312 – 3143

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3G73X-ray2.21A/B222-360[»]
ProteinModelPortaliQ08050.
SMRiQ08050. Positions 234-328.

Miscellaneous databases

EvolutionaryTraceiQ08050.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi480 – 51334Glu/Pro/Ser/Thr-rich
Add
BLAST

Domaini

Within the protein there is a domain which acts as a transcriptional activator. Insertion of a splicing sequence within it inactivates this transcriptional activity, as it is the case for isoform 4.

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG5025.
HOGENOMiHOG000112633.
HOVERGENiHBG051652.
KOiK09406.
OMAiFKTPIKE.
OrthoDBiEOG7SJD4C.
PhylomeDBiQ08050.
TreeFamiTF333250.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR001766. TF_fork_head.
IPR018122. TF_fork_head_CS.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00250. Fork_head. 1 hit.
[Graphical view]
PRINTSiPR00053. FORKHEAD.
SMARTiSM00339. FH. 1 hit.
[Graphical view]
PROSITEiPS00657. FORK_HEAD_1. 1 hit.
PS00658. FORK_HEAD_2. 1 hit.
PS50039. FORK_HEAD_3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Note: Isoform 1 and isoform 2 appear to be the only activators of gene transcription. Isoform 3, found in rat, does not seem to exist in human.

Isoform 1 (identifier: Q08050-1) [UniParc]FASTAAdd to Basket

Also known as: FoxM1C, FOXM1-c

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKTSPRRPLI LKRRRLPLPV QNAPSETSEE EPKRSPAQQE SNQAEASKEV    50
AESNSCKFPA GIKIINHPTM PNTQVVAIPN NANIHSIITA LTAKGKESGS 100
SGPNKFILIS CGGAPTQPPG LRPQTQTSYD AKRTEVTLET LGPKPAARDV 150
NLPRPPGALC EQKRETCADG EAAGCTINNS LSNIQWLRKM SSDGLGSRSI 200
KQEMEEKENC HLEQRQVKVE EPSRPSASWQ NSVSERPPYS YMAMIQFAIN 250
STERKRMTLK DIYTWIEDHF PYFKHIAKPG WKNSIRHNLS LHDMFVRETS 300
ANGKVSFWTI HPSANRYLTL DQVFKPLDPG SPQLPEHLES QQKRPNPELR 350
RNMTIKTELP LGARRKMKPL LPRVSSYLVP IQFPVNQSLV LQPSVKVPLP 400
LAASLMSSEL ARHSKRVRIA PKVLLAEEGI APLSSAGPGK EEKLLFGEGF 450
SPLLPVQTIK EEEIQPGEEM PHLARPIKVE SPPLEEWPSP APSFKEESSH 500
SWEDSSQSPT PRPKKSYSGL RSPTRCVSEM LVIQHRERRE RSRSRRKQHL 550
LPPCVDEPEL LFSEGPSTSR WAAELPFPAD SSDPASQLSY SQEVGGPFKT 600
PIKETLPISS TPSKSVLPRT PESWRLTPPA KVGGLDFSPV QTSQGASDPL 650
PDPLGLMDLS TTPLQSAPPL ESPQRLLSSE PLDLISVPFG NSSPSDIDVP 700
KPGSPEPQVS GLAANRSLTE GLVLDTMNDS LSKILLDISF PGLDEDPLGP 750
DNINWSQFIP ELQ 763
Length:763
Mass (Da):84,283
Last modified:December 1, 2000 - v3
Checksum:i963CAC8FE7498E9B
GO
Isoform 2 (identifier: Q08050-2) [UniParc]FASTAAdd to Basket

Also known as: FoxM1B, FOXM1-b

The sequence of this isoform differs from the canonical sequence as follows:
     326-340: Missing.

Show »
Length:748
Mass (Da):82,685
Checksum:i3224A22B1434A531
GO
Isoform 4 (identifier: Q08050-3) [UniParc]FASTAAdd to Basket

Also known as: FoxM1A, FOXM1-a

The sequence of this isoform differs from the canonical sequence as follows:
     423-423: V → VFGEQVVFGYMSKFFSGDLRDFGTPITSLFNFIFLCLSV

Show »
Length:801
Mass (Da):88,596
Checksum:i82416A3FA271C5D5
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti402 – 4021A → E.1 Publication
Corresponds to variant rs28990715 [ dbSNP | Ensembl ].
VAR_025239
Natural varianti450 – 4501F → L.1 Publication
Corresponds to variant rs28919868 [ dbSNP | Ensembl ].
VAR_025240
Natural varianti643 – 6431S → P.2 Publications
Corresponds to variant rs3742076 [ dbSNP | Ensembl ].
VAR_020024
Natural varianti669 – 6691P → R.1 Publication
Corresponds to variant rs28919869 [ dbSNP | Ensembl ].
VAR_025241
Natural varianti673 – 6731P → L.1 Publication
Corresponds to variant rs28919870 [ dbSNP | Ensembl ].
VAR_025242

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei326 – 34015Missing in isoform 2.
VSP_001547Add
BLAST
Alternative sequencei423 – 4231V → VFGEQVVFGYMSKFFSGDLR DFGTPITSLFNFIFLCLSV in isoform 4.
VSP_001548

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti3 – 31T → A in AAC63595. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U74612 mRNA. Translation: AAC51128.1.
U74613 mRNA. Translation: AAC51129.1.
U83113 mRNA. Translation: AAC63595.1.
DQ022289 Genomic DNA. Translation: AAY26401.1.
BC006192 mRNA. Translation: AAH06192.1.
BC006529 mRNA. Translation: AAH06529.1.
BC012863 mRNA. Translation: AAH12863.1.
L16783 mRNA. Translation: AAC37541.1.
CCDSiCCDS8515.1. [Q08050-1]
CCDS8516.1. [Q08050-3]
CCDS8517.1. [Q08050-2]
PIRiB36881.
RefSeqiNP_001230017.1. NM_001243088.1.
NP_001230018.1. NM_001243089.1.
NP_068772.2. NM_021953.3. [Q08050-1]
NP_973731.1. NM_202002.2. [Q08050-3]
NP_973732.1. NM_202003.2. [Q08050-2]
UniGeneiHs.239.
Hs.735243.

Genome annotation databases

EnsembliENST00000342628; ENSP00000342307; ENSG00000111206. [Q08050-3]
ENST00000359843; ENSP00000352901; ENSG00000111206. [Q08050-1]
ENST00000361953; ENSP00000354492; ENSG00000111206. [Q08050-2]
GeneIDi2305.
KEGGihsa:2305.
UCSCiuc001qle.3. human. [Q08050-3]
uc001qlf.3. human. [Q08050-1]
uc001qlg.3. human. [Q08050-2]

Polymorphism databases

DMDMi12644391.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U74612 mRNA. Translation: AAC51128.1 .
U74613 mRNA. Translation: AAC51129.1 .
U83113 mRNA. Translation: AAC63595.1 .
DQ022289 Genomic DNA. Translation: AAY26401.1 .
BC006192 mRNA. Translation: AAH06192.1 .
BC006529 mRNA. Translation: AAH06529.1 .
BC012863 mRNA. Translation: AAH12863.1 .
L16783 mRNA. Translation: AAC37541.1 .
CCDSi CCDS8515.1. [Q08050-1 ]
CCDS8516.1. [Q08050-3 ]
CCDS8517.1. [Q08050-2 ]
PIRi B36881.
RefSeqi NP_001230017.1. NM_001243088.1.
NP_001230018.1. NM_001243089.1.
NP_068772.2. NM_021953.3. [Q08050-1 ]
NP_973731.1. NM_202002.2. [Q08050-3 ]
NP_973732.1. NM_202003.2. [Q08050-2 ]
UniGenei Hs.239.
Hs.735243.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3G73 X-ray 2.21 A/B 222-360 [» ]
ProteinModelPortali Q08050.
SMRi Q08050. Positions 234-328.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108594. 26 interactions.
DIPi DIP-36754N.
IntActi Q08050. 13 interactions.
MINTi MINT-107757.
STRINGi 9606.ENSP00000342307.

PTM databases

PhosphoSitei Q08050.

Polymorphism databases

DMDMi 12644391.

Proteomic databases

MaxQBi Q08050.
PaxDbi Q08050.
PRIDEi Q08050.

Protocols and materials databases

DNASUi 2305.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000342628 ; ENSP00000342307 ; ENSG00000111206 . [Q08050-3 ]
ENST00000359843 ; ENSP00000352901 ; ENSG00000111206 . [Q08050-1 ]
ENST00000361953 ; ENSP00000354492 ; ENSG00000111206 . [Q08050-2 ]
GeneIDi 2305.
KEGGi hsa:2305.
UCSCi uc001qle.3. human. [Q08050-3 ]
uc001qlf.3. human. [Q08050-1 ]
uc001qlg.3. human. [Q08050-2 ]

Organism-specific databases

CTDi 2305.
GeneCardsi GC12M002966.
HGNCi HGNC:3818. FOXM1.
HPAi CAB017832.
HPA029974.
HPA029975.
HPA029976.
MIMi 602341. gene.
neXtProti NX_Q08050.
PharmGKBi PA28236.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5025.
HOGENOMi HOG000112633.
HOVERGENi HBG051652.
KOi K09406.
OMAi FKTPIKE.
OrthoDBi EOG7SJD4C.
PhylomeDBi Q08050.
TreeFami TF333250.

Enzyme and pathway databases

Reactomei REACT_1006. Polo-like kinase mediated events.
REACT_1857. Cyclin A/B1 associated events during G2/M transition.

Miscellaneous databases

EvolutionaryTracei Q08050.
GeneWikii FOXM1.
GenomeRNAii 2305.
NextBioi 9359.
PROi Q08050.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q08050.
Bgeei Q08050.
CleanExi HS_FOXM1.
HS_MPP2.
Genevestigatori Q08050.

Family and domain databases

Gene3Di 1.10.10.10. 1 hit.
InterProi IPR001766. TF_fork_head.
IPR018122. TF_fork_head_CS.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view ]
Pfami PF00250. Fork_head. 1 hit.
[Graphical view ]
PRINTSi PR00053. FORKHEAD.
SMARTi SM00339. FH. 1 hit.
[Graphical view ]
PROSITEi PS00657. FORK_HEAD_1. 1 hit.
PS00658. FORK_HEAD_2. 1 hit.
PS50039. FORK_HEAD_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Hepatocyte nuclear factor 3/fork head homolog 11 is expressed in proliferating epithelial and mesenchymal cells of embryonic and adult tissues."
    Ye H., Kelly T.F., Samadani U., Lim L., Rubio S., Overdier D.G., Roebuck K.A., Costa R.H.
    Mol. Cell. Biol. 17:1626-1641(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4).
    Tissue: Colon carcinoma.
  2. "Molecular analysis of a novel winged helix protein, WIN. Expression pattern, DNA binding property, and alternative splicing within the DNA binding domain."
    Yao K.-M., Sha M., Lu Z., Wong G.G.
    J. Biol. Chem. 272:19827-19836(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Pancreatic carcinoma and Testis.
  3. NIEHS SNPs program
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLU-402; LEU-450; PRO-643; ARG-669 AND LEU-673.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT PRO-643.
    Tissue: Lung, Ovary and Skin.
  5. "Cloning of cDNAs for M-phase phosphoproteins recognized by the MPM2 monoclonal antibody and determination of the phosphorylated epitope."
    Westendorf J.M., Rao P.N., Gerace L.
    Proc. Natl. Acad. Sci. U.S.A. 91:714-718(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 543-763.
    Tissue: Lymphoblast.
  6. "Chk2 mediates stabilization of the FoxM1 transcription factor to stimulate expression of DNA repair genes."
    Tan Y., Raychaudhuri P., Costa R.H.
    Mol. Cell. Biol. 27:1007-1016(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN DNA REPAIR, PHOSPHORYLATION AT SER-376 BY CHEK2.
  7. "Plk1-dependent phosphorylation of FoxM1 regulates a transcriptional programme required for mitotic progression."
    Fu Z., Malureanu L., Huang J., Wang W., Li H., van Deursen J.M., Tindall D.J., Chen J.
    Nat. Cell Biol. 10:1076-1082(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, PHOSPHORYLATION AT THR-611; SER-693; SER-730 AND SER-739, MUTAGENESIS OF THR-611; SER-693; SER-730 AND SER-739.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-331; THR-620 AND THR-627, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-730 AND SER-739, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. Cited for: X-RAY CRYSTALLOGRAPHY (2.21 ANGSTROMS) OF 222-360 IN COMPLEX WITH PROMOTER DNA, FUNCTION.

Entry informationi

Entry nameiFOXM1_HUMAN
AccessioniPrimary (citable) accession number: Q08050
Secondary accession number(s): O43258
, O43259, O43260, Q4ZGG7, Q9BRL2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: December 1, 2000
Last modified: September 3, 2014
This is version 153 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi