Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q08050

- FOXM1_HUMAN

UniProt

Q08050 - FOXM1_HUMAN

Protein

Forkhead box protein M1

Gene

FOXM1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 154 (01 Oct 2014)
      Sequence version 3 (01 Dec 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.3 Publications

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi235 – 32793Fork-headPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB
    2. protein binding Source: IntAct
    3. protein kinase binding Source: UniProtKB
    4. sequence-specific DNA binding Source: InterPro
    5. sequence-specific DNA binding transcription factor activity Source: UniProtKB
    6. transcription regulatory region DNA binding Source: Ensembl

    GO - Biological processi

    1. cell cycle Source: UniProtKB
    2. DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator Source: UniProtKB
    3. DNA repair Source: UniProtKB-KW
    4. G2/M transition of mitotic cell cycle Source: UniProtKB
    5. liver development Source: Ensembl
    6. mitotic cell cycle Source: Reactome
    7. negative regulation of cell aging Source: UniProtKB
    8. negative regulation of stress-activated MAPK cascade Source: BHF-UCL
    9. negative regulation of transcription, DNA-templated Source: BHF-UCL
    10. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
    11. positive regulation of cell proliferation Source: BHF-UCL
    12. positive regulation of double-strand break repair Source: UniProtKB
    13. positive regulation of transcription, DNA-templated Source: UniProtKB
    14. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
    15. regulation of cell cycle Source: Reactome
    16. regulation of cell cycle arrest Source: BHF-UCL
    17. regulation of cell growth Source: UniProtKB
    18. regulation of cell proliferation Source: UniProtKB
    19. regulation of Ras protein signal transduction Source: BHF-UCL
    20. regulation of reactive oxygen species metabolic process Source: BHF-UCL
    21. regulation of transcription, DNA-templated Source: GOC
    22. transcription, DNA-templated Source: UniProtKB-KW
    23. transcription from RNA polymerase II promoter Source: UniProtKB
    24. vasculogenesis Source: Ensembl

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Cell cycle, DNA damage, DNA repair, Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_1006. Polo-like kinase mediated events.
    REACT_1857. Cyclin A/B1 associated events during G2/M transition.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Forkhead box protein M1
    Alternative name(s):
    Forkhead-related protein FKHL16
    Hepatocyte nuclear factor 3 forkhead homolog 11
    Short name:
    HFH-11
    Short name:
    HNF-3/fork-head homolog 11
    M-phase phosphoprotein 2
    MPM-2 reactive phosphoprotein 2
    Transcription factor Trident
    Winged-helix factor from INS-1 cells
    Gene namesi
    Name:FOXM1
    Synonyms:FKHL16, HFH11, MPP2, WIN
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:3818. FOXM1.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. nucleoplasm Source: Reactome
    3. nucleus Source: HPA

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi611 – 6111T → A: Prevents phosphorylation by CDK1 and subsequent binding of POLO box domains of PLK1; when associated with A-693. 1 Publication
    Mutagenesisi693 – 6931S → A: Prevents phosphorylation by CDK1 and subsequent binding of POLO box domains of PLK1; when associated with A-611. 1 Publication
    Mutagenesisi730 – 7301S → A: Prevents phosphorylation by PLK1 and impairs transcription activity; when associated with A-739. 1 Publication
    Mutagenesisi739 – 7391S → A: Prevents phosphorylation by PLK1 and impairs transcription activity; when associated with A-730. 1 Publication

    Organism-specific databases

    PharmGKBiPA28236.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 763763Forkhead box protein M1PRO_0000091863Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei331 – 3311Phosphoserine1 Publication
    Modified residuei376 – 3761Phosphoserine; by CHEK21 Publication
    Modified residuei611 – 6111Phosphothreonine; by CDK11 Publication
    Modified residuei620 – 6201Phosphothreonine1 Publication
    Modified residuei627 – 6271Phosphothreonine1 Publication
    Modified residuei662 – 6621PhosphothreonineCurated
    Modified residuei693 – 6931Phosphoserine; by CDK11 Publication
    Modified residuei730 – 7301Phosphoserine; by PLK12 Publications
    Modified residuei739 – 7391Phosphoserine; by PLK12 Publications

    Post-translational modificationi

    Phosphorylated in M (mitotic) phase. Phosphorylation by the checkpoint kinase CHEK2 in response to DNA damage increases the FOXM1 protein stability probably stimulating the transcription of genes involved in DNA repair. Phosphorylated by CDK1 in late S and G2 phases, creating docking sites for the POLO box domains of PLK1. Subsequently, PLK1 binds and phosphorylates FOXM1, leading to activation of transcriptional activity and subsequent enhanced expression of key mitotic regulators.4 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ08050.
    PaxDbiQ08050.
    PRIDEiQ08050.

    PTM databases

    PhosphoSiteiQ08050.

    Expressioni

    Tissue specificityi

    Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Isoform 2 is highly expressed in testis.

    Developmental stagei

    Embryonic expression pattern: liver, lung, intestine, kidney, urinary tract; adult expression pattern: intestine, colon, testis and thymus.

    Inductioni

    Induced during liver regeneration and oxidative stress.

    Gene expression databases

    ArrayExpressiQ08050.
    BgeeiQ08050.
    CleanExiHS_FOXM1.
    HS_MPP2.
    GenevestigatoriQ08050.

    Organism-specific databases

    HPAiCAB017832.
    HPA029974.
    HPA029975.
    HPA029976.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CCNE1P248642EBI-866480,EBI-519526
    CDK6Q005342EBI-866499,EBI-295663
    CTNNB1P3522216EBI-866480,EBI-491549
    E7P031293EBI-866499,EBI-866453From a different organism.
    FOXO3O435242EBI-866480,EBI-1644164

    Protein-protein interaction databases

    BioGridi108594. 26 interactions.
    DIPiDIP-36754N.
    IntActiQ08050. 13 interactions.
    MINTiMINT-107757.
    STRINGi9606.ENSP00000342307.

    Structurei

    Secondary structure

    1
    763
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi241 – 25010
    Beta strandi255 – 2573
    Helixi259 – 26911
    Helixi272 – 2754
    Helixi281 – 29111
    Beta strandi295 – 2995
    Beta strandi306 – 3105
    Turni312 – 3143

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3G73X-ray2.21A/B222-360[»]
    ProteinModelPortaliQ08050.
    SMRiQ08050. Positions 234-328.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ08050.

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi480 – 51334Glu/Pro/Ser/Thr-richAdd
    BLAST

    Domaini

    Within the protein there is a domain which acts as a transcriptional activator. Insertion of a splicing sequence within it inactivates this transcriptional activity, as it is the case for isoform 4.

    Sequence similaritiesi

    Contains 1 fork-head DNA-binding domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG5025.
    HOGENOMiHOG000112633.
    HOVERGENiHBG051652.
    KOiK09406.
    OMAiFKTPIKE.
    OrthoDBiEOG7SJD4C.
    PhylomeDBiQ08050.
    TreeFamiTF333250.

    Family and domain databases

    Gene3Di1.10.10.10. 1 hit.
    InterProiIPR001766. TF_fork_head.
    IPR018122. TF_fork_head_CS.
    IPR011991. WHTH_DNA-bd_dom.
    [Graphical view]
    PfamiPF00250. Fork_head. 1 hit.
    [Graphical view]
    PRINTSiPR00053. FORKHEAD.
    SMARTiSM00339. FH. 1 hit.
    [Graphical view]
    PROSITEiPS00657. FORK_HEAD_1. 1 hit.
    PS00658. FORK_HEAD_2. 1 hit.
    PS50039. FORK_HEAD_3. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Note: Isoform 1 and isoform 2 appear to be the only activators of gene transcription. Isoform 3, found in rat, does not seem to exist in human.

    Isoform 1 (identifier: Q08050-1) [UniParc]FASTAAdd to Basket

    Also known as: FoxM1C, FOXM1-c

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKTSPRRPLI LKRRRLPLPV QNAPSETSEE EPKRSPAQQE SNQAEASKEV    50
    AESNSCKFPA GIKIINHPTM PNTQVVAIPN NANIHSIITA LTAKGKESGS 100
    SGPNKFILIS CGGAPTQPPG LRPQTQTSYD AKRTEVTLET LGPKPAARDV 150
    NLPRPPGALC EQKRETCADG EAAGCTINNS LSNIQWLRKM SSDGLGSRSI 200
    KQEMEEKENC HLEQRQVKVE EPSRPSASWQ NSVSERPPYS YMAMIQFAIN 250
    STERKRMTLK DIYTWIEDHF PYFKHIAKPG WKNSIRHNLS LHDMFVRETS 300
    ANGKVSFWTI HPSANRYLTL DQVFKPLDPG SPQLPEHLES QQKRPNPELR 350
    RNMTIKTELP LGARRKMKPL LPRVSSYLVP IQFPVNQSLV LQPSVKVPLP 400
    LAASLMSSEL ARHSKRVRIA PKVLLAEEGI APLSSAGPGK EEKLLFGEGF 450
    SPLLPVQTIK EEEIQPGEEM PHLARPIKVE SPPLEEWPSP APSFKEESSH 500
    SWEDSSQSPT PRPKKSYSGL RSPTRCVSEM LVIQHRERRE RSRSRRKQHL 550
    LPPCVDEPEL LFSEGPSTSR WAAELPFPAD SSDPASQLSY SQEVGGPFKT 600
    PIKETLPISS TPSKSVLPRT PESWRLTPPA KVGGLDFSPV QTSQGASDPL 650
    PDPLGLMDLS TTPLQSAPPL ESPQRLLSSE PLDLISVPFG NSSPSDIDVP 700
    KPGSPEPQVS GLAANRSLTE GLVLDTMNDS LSKILLDISF PGLDEDPLGP 750
    DNINWSQFIP ELQ 763
    Length:763
    Mass (Da):84,283
    Last modified:December 1, 2000 - v3
    Checksum:i963CAC8FE7498E9B
    GO
    Isoform 2 (identifier: Q08050-2) [UniParc]FASTAAdd to Basket

    Also known as: FoxM1B, FOXM1-b

    The sequence of this isoform differs from the canonical sequence as follows:
         326-340: Missing.

    Show »
    Length:748
    Mass (Da):82,685
    Checksum:i3224A22B1434A531
    GO
    Isoform 4 (identifier: Q08050-3) [UniParc]FASTAAdd to Basket

    Also known as: FoxM1A, FOXM1-a

    The sequence of this isoform differs from the canonical sequence as follows:
         423-423: V → VFGEQVVFGYMSKFFSGDLRDFGTPITSLFNFIFLCLSV

    Show »
    Length:801
    Mass (Da):88,596
    Checksum:i82416A3FA271C5D5
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti3 – 31T → A in AAC63595. (PubMed:9242644)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti402 – 4021A → E.1 Publication
    Corresponds to variant rs28990715 [ dbSNP | Ensembl ].
    VAR_025239
    Natural varianti450 – 4501F → L.1 Publication
    Corresponds to variant rs28919868 [ dbSNP | Ensembl ].
    VAR_025240
    Natural varianti643 – 6431S → P.2 Publications
    Corresponds to variant rs3742076 [ dbSNP | Ensembl ].
    VAR_020024
    Natural varianti669 – 6691P → R.1 Publication
    Corresponds to variant rs28919869 [ dbSNP | Ensembl ].
    VAR_025241
    Natural varianti673 – 6731P → L.1 Publication
    Corresponds to variant rs28919870 [ dbSNP | Ensembl ].
    VAR_025242

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei326 – 34015Missing in isoform 2. 2 PublicationsVSP_001547Add
    BLAST
    Alternative sequencei423 – 4231V → VFGEQVVFGYMSKFFSGDLR DFGTPITSLFNFIFLCLSV in isoform 4. 1 PublicationVSP_001548

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U74612 mRNA. Translation: AAC51128.1.
    U74613 mRNA. Translation: AAC51129.1.
    U83113 mRNA. Translation: AAC63595.1.
    DQ022289 Genomic DNA. Translation: AAY26401.1.
    BC006192 mRNA. Translation: AAH06192.1.
    BC006529 mRNA. Translation: AAH06529.1.
    BC012863 mRNA. Translation: AAH12863.1.
    L16783 mRNA. Translation: AAC37541.1.
    CCDSiCCDS8515.1. [Q08050-1]
    CCDS8516.1. [Q08050-3]
    CCDS8517.1. [Q08050-2]
    PIRiB36881.
    RefSeqiNP_001230017.1. NM_001243088.1.
    NP_001230018.1. NM_001243089.1.
    NP_068772.2. NM_021953.3. [Q08050-1]
    NP_973731.1. NM_202002.2. [Q08050-3]
    NP_973732.1. NM_202003.2. [Q08050-2]
    UniGeneiHs.239.
    Hs.735243.

    Genome annotation databases

    EnsembliENST00000342628; ENSP00000342307; ENSG00000111206. [Q08050-3]
    ENST00000359843; ENSP00000352901; ENSG00000111206. [Q08050-1]
    ENST00000361953; ENSP00000354492; ENSG00000111206. [Q08050-2]
    GeneIDi2305.
    KEGGihsa:2305.
    UCSCiuc001qle.3. human. [Q08050-3]
    uc001qlf.3. human. [Q08050-1]
    uc001qlg.3. human. [Q08050-2]

    Polymorphism databases

    DMDMi12644391.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology
    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U74612 mRNA. Translation: AAC51128.1 .
    U74613 mRNA. Translation: AAC51129.1 .
    U83113 mRNA. Translation: AAC63595.1 .
    DQ022289 Genomic DNA. Translation: AAY26401.1 .
    BC006192 mRNA. Translation: AAH06192.1 .
    BC006529 mRNA. Translation: AAH06529.1 .
    BC012863 mRNA. Translation: AAH12863.1 .
    L16783 mRNA. Translation: AAC37541.1 .
    CCDSi CCDS8515.1. [Q08050-1 ]
    CCDS8516.1. [Q08050-3 ]
    CCDS8517.1. [Q08050-2 ]
    PIRi B36881.
    RefSeqi NP_001230017.1. NM_001243088.1.
    NP_001230018.1. NM_001243089.1.
    NP_068772.2. NM_021953.3. [Q08050-1 ]
    NP_973731.1. NM_202002.2. [Q08050-3 ]
    NP_973732.1. NM_202003.2. [Q08050-2 ]
    UniGenei Hs.239.
    Hs.735243.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3G73 X-ray 2.21 A/B 222-360 [» ]
    ProteinModelPortali Q08050.
    SMRi Q08050. Positions 234-328.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 108594. 26 interactions.
    DIPi DIP-36754N.
    IntActi Q08050. 13 interactions.
    MINTi MINT-107757.
    STRINGi 9606.ENSP00000342307.

    PTM databases

    PhosphoSitei Q08050.

    Polymorphism databases

    DMDMi 12644391.

    Proteomic databases

    MaxQBi Q08050.
    PaxDbi Q08050.
    PRIDEi Q08050.

    Protocols and materials databases

    DNASUi 2305.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000342628 ; ENSP00000342307 ; ENSG00000111206 . [Q08050-3 ]
    ENST00000359843 ; ENSP00000352901 ; ENSG00000111206 . [Q08050-1 ]
    ENST00000361953 ; ENSP00000354492 ; ENSG00000111206 . [Q08050-2 ]
    GeneIDi 2305.
    KEGGi hsa:2305.
    UCSCi uc001qle.3. human. [Q08050-3 ]
    uc001qlf.3. human. [Q08050-1 ]
    uc001qlg.3. human. [Q08050-2 ]

    Organism-specific databases

    CTDi 2305.
    GeneCardsi GC12M002966.
    HGNCi HGNC:3818. FOXM1.
    HPAi CAB017832.
    HPA029974.
    HPA029975.
    HPA029976.
    MIMi 602341. gene.
    neXtProti NX_Q08050.
    PharmGKBi PA28236.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5025.
    HOGENOMi HOG000112633.
    HOVERGENi HBG051652.
    KOi K09406.
    OMAi FKTPIKE.
    OrthoDBi EOG7SJD4C.
    PhylomeDBi Q08050.
    TreeFami TF333250.

    Enzyme and pathway databases

    Reactomei REACT_1006. Polo-like kinase mediated events.
    REACT_1857. Cyclin A/B1 associated events during G2/M transition.

    Miscellaneous databases

    EvolutionaryTracei Q08050.
    GeneWikii FOXM1.
    GenomeRNAii 2305.
    NextBioi 9359.
    PROi Q08050.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q08050.
    Bgeei Q08050.
    CleanExi HS_FOXM1.
    HS_MPP2.
    Genevestigatori Q08050.

    Family and domain databases

    Gene3Di 1.10.10.10. 1 hit.
    InterProi IPR001766. TF_fork_head.
    IPR018122. TF_fork_head_CS.
    IPR011991. WHTH_DNA-bd_dom.
    [Graphical view ]
    Pfami PF00250. Fork_head. 1 hit.
    [Graphical view ]
    PRINTSi PR00053. FORKHEAD.
    SMARTi SM00339. FH. 1 hit.
    [Graphical view ]
    PROSITEi PS00657. FORK_HEAD_1. 1 hit.
    PS00658. FORK_HEAD_2. 1 hit.
    PS50039. FORK_HEAD_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Hepatocyte nuclear factor 3/fork head homolog 11 is expressed in proliferating epithelial and mesenchymal cells of embryonic and adult tissues."
      Ye H., Kelly T.F., Samadani U., Lim L., Rubio S., Overdier D.G., Roebuck K.A., Costa R.H.
      Mol. Cell. Biol. 17:1626-1641(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4).
      Tissue: Colon carcinoma.
    2. "Molecular analysis of a novel winged helix protein, WIN. Expression pattern, DNA binding property, and alternative splicing within the DNA binding domain."
      Yao K.-M., Sha M., Lu Z., Wong G.G.
      J. Biol. Chem. 272:19827-19836(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Pancreatic carcinoma and Testis.
    3. NIEHS SNPs program
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLU-402; LEU-450; PRO-643; ARG-669 AND LEU-673.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT PRO-643.
      Tissue: Lung, Ovary and Skin.
    5. "Cloning of cDNAs for M-phase phosphoproteins recognized by the MPM2 monoclonal antibody and determination of the phosphorylated epitope."
      Westendorf J.M., Rao P.N., Gerace L.
      Proc. Natl. Acad. Sci. U.S.A. 91:714-718(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 543-763.
      Tissue: Lymphoblast.
    6. "Chk2 mediates stabilization of the FoxM1 transcription factor to stimulate expression of DNA repair genes."
      Tan Y., Raychaudhuri P., Costa R.H.
      Mol. Cell. Biol. 27:1007-1016(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN DNA REPAIR, PHOSPHORYLATION AT SER-376 BY CHEK2.
    7. "Plk1-dependent phosphorylation of FoxM1 regulates a transcriptional programme required for mitotic progression."
      Fu Z., Malureanu L., Huang J., Wang W., Li H., van Deursen J.M., Tindall D.J., Chen J.
      Nat. Cell Biol. 10:1076-1082(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, PHOSPHORYLATION AT THR-611; SER-693; SER-730 AND SER-739, MUTAGENESIS OF THR-611; SER-693; SER-730 AND SER-739.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-331; THR-620 AND THR-627, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-730 AND SER-739, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. Cited for: X-RAY CRYSTALLOGRAPHY (2.21 ANGSTROMS) OF 222-360 IN COMPLEX WITH PROMOTER DNA, FUNCTION.

    Entry informationi

    Entry nameiFOXM1_HUMAN
    AccessioniPrimary (citable) accession number: Q08050
    Secondary accession number(s): O43258
    , O43259, O43260, Q4ZGG7, Q9BRL2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: December 1, 2000
    Last modified: October 1, 2014
    This is version 154 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3