Reviewed,
UniProtKB/Swiss-Prot Q08050 (FOXM1_HUMAN)
Last modified
June 16, 2009.
Version 99.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Forkhead box protein M1 Alternative name(s): Forkhead-related protein FKHL16 Hepatocyte nuclear factor 3 forkhead homolog 11 Short name=HNF-3/fork-head homolog 11 Short name=HFH-11 Winged-helix factor from INS-1 cells M-phase phosphoprotein 2 MPM-2 reactive phosphoprotein 2 Transcription factor Trident | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 763 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Transcriptional activatory factor. May play a role in the control of cell proliferation. |
| Subcellular location | |
| Tissue specificity | Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. |
| Developmental stage | Embryonic expression pattern: liver, lung, intestine, kidney, urinary tract; adult expression pattern: intestine, colon, testis and thymus. |
| Induction | Induced during liver regeneration and oxidative stress. |
| Domain | Within the protein there is a domain which acts as a transcriptional activator. Insertion of a splicing sequence within it inactivates this transcriptional activity, as it is the case for isoform 4. |
| Post-translational modification | |
| Sequence similarities | Contains 1 fork-head DNA-binding domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | DNA-binding |
| Molecular function | Activator |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | regulation of transcription, DNA-dependent Inferred from electronic annotation. Source: UniProtKB-KW transcriptionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct sequence-specific DNA bindingInferred from electronic annotation. Source: InterPro transcription factor activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| E7 | P03129 | 2 | EBI-866499,EBI-866453 | From a different organism. |
| FOXO3 | O43524 | 1 | EBI-866480,EBI-1644164 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Isoform 1 and isoform 2 appear to be the only activators of gene transcription. Isoform 3, found in rat, does not seem to exist in human. | ||||||
| Isoform 1 (identifier: Q08050-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q08050-2) The sequence of this isoform differs from the canonical sequence as follows: 326-340: Missing. | ||||||
| Note: Highly expressed in testis. | ||||||
| Isoform 4 (identifier: Q08050-3) The sequence of this isoform differs from the canonical sequence as follows: 423-423: V → FGEQVVFGYMSKFFSGDLRDFGTPITSLFNFIFLCLSV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 763 | 763 | Forkhead box protein M1 | PRO_0000091863 | |||||
Regions | |||||||||
| DNA binding | 235 – 327 | 93 | Fork-head | ||||||
| Compositional bias | 480 – 513 | 34 | Glu/Pro/Ser/Thr-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 331 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 620 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 627 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 662 | 1 | Phosphothreonine Probable | ||||||
| Modified residue | 704 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 326 – 340 | 15 | Missing in isoform 2. | VSP_001547 | |||||
| Alternative sequence | 423 | 1 | V → FGEQVVFGYMSKFFSGDLRD FGTPITSLFNFIFLCLSV in isoform 4. | VSP_001548 | |||||
| Natural variant | 402 | 1 | A → E: dbSNP rs28990715. Ref.3 | VAR_025239 | |||||
| Natural variant | 450 | 1 | F → L: dbSNP rs28919868. Ref.3 | VAR_025240 | |||||
| Natural variant | 643 | 1 | S → P: dbSNP rs3742076. Ref.3 Ref.4 | VAR_020024 | |||||
| Natural variant | 669 | 1 | P → R: dbSNP rs28919869. Ref.3 | VAR_025241 | |||||
| Natural variant | 673 | 1 | P → L: dbSNP rs28919870. Ref.3 | VAR_025242 | |||||
Experimental info | |||||||||
| Sequence conflict | 3 | 1 | T → A in AAC63595. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Hepatocyte nuclear factor 3/fork head homolog 11 is expressed in proliferating epithelial and mesenchymal cells of embryonic and adult tissues." Ye H., Kelly T.F., Samadani U., Lim L., Rubio S., Overdier D.G., Roebuck K.A., Costa R.H. Mol. Cell. Biol. 17:1626-1641(1997) [PubMed: 9032290] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4). Tissue: Colon carcinoma. |
| [2] | "Molecular analysis of a novel winged helix protein, WIN. Expression pattern, DNA binding property, and alternative splicing within the DNA binding domain." Yao K.-M., Sha M., Lu Z., Wong G.G. J. Biol. Chem. 272:19827-19836(1997) [PubMed: 9242644] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Pancreatic carcinoma and Testis. |
| [3] | NIEHS SNPs program Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLU-402; LEU-450; PRO-643; ARG-669 AND LEU-673. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT PRO-643. Tissue: Lung, Ovary and Skin. |
| [5] | "Cloning of cDNAs for M-phase phosphoproteins recognized by the MPM2 monoclonal antibody and determination of the phosphorylated epitope." Westendorf J.M., Rao P.N., Gerace L. Proc. Natl. Acad. Sci. U.S.A. 91:714-718(1994) [PubMed: 8290587] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 543-763. Tissue: Lymphoblast. |
| [6] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-704, MASS SPECTROMETRY. Tissue: Epithelium. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-331; THR-620 AND THR-627, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U74612 mRNA. Translation: AAC51128.1. U74613 mRNA. Translation: AAC51129.1. U83113 mRNA. Translation: AAC63595.1. DQ022289 Genomic DNA. Translation: AAY26401.1. BC006192 mRNA. Translation: AAH06192.1. BC006529 mRNA. Translation: AAH06529.1. BC012863 mRNA. Translation: AAH12863.1. L16783 mRNA. Translation: AAC37541.1. | |||||||||||||
| IPI | IPI00032162. IPI00216686. IPI00401044. | ||||||||||||
| PIR | B36881. | ||||||||||||
| RefSeq | NP_068772.2. NP_973731.1. NP_973732.1. | ||||||||||||
| UniGene | Hs.239 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q08050. 7 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q08050. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q08050. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000111206. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 2305. | ||||||||||||
| KEGG | hsa:2305. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC12M002837. | ||||||||||||
| H-InvDB | HIX0010334. | ||||||||||||
| HGNC | HGNC:3818. FOXM1. | ||||||||||||
| HPA | CAB017832. | ||||||||||||
| MIM | 602341. gene. | ||||||||||||
| PharmGKB | PA28236. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | Q08050. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | foxm1pathway. FOXM1 transcription factor network. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q08050. | ||||||||||||
| Bgee | Q08050. | ||||||||||||
| CleanEx | HS_FOXM1. HS_MPP2. | ||||||||||||
| GermOnline | ENSG00000111206. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR001766. TF_fork_head. IPR018122. TF_fork_head_CS. IPR011991. Wing_hlx_DNA_bd. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:1.10.10.10. Wing_hlx_DNA_bd. 1 hit. | ||||||||||||
| PANTHER | PTHR11829. Fork_box_protein. 1 hit. | ||||||||||||
| Pfam | PF00250. Fork_head. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00053. FORKHEAD. | ||||||||||||
| ProDom | PD000425. TF_Fork_head. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||
| SMART | SM00339. FH. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00657. FORK_HEAD_1. 1 hit. PS00658. FORK_HEAD_2. 1 hit. PS50039. FORK_HEAD_3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 9359. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | FOXM1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q08050 Secondary accession number(s): O43258 Q9BRL2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


