Q08050 (FOXM1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 141.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Forkhead box protein M1 Alternative name(s): Forkhead-related protein FKHL16 Hepatocyte nuclear factor 3 forkhead homolog 11 Short name=HFH-11 Short name=HNF-3/fork-head homolog 11 M-phase phosphoprotein 2 MPM-2 reactive phosphoprotein 2 Transcription factor Trident Winged-helix factor from INS-1 cells | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 763 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response. Ref.6 Ref.7 Ref.10 |
| Subcellular location | |
| Tissue specificity | Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Isoform 2 is highly expressed in testis. |
| Developmental stage | Embryonic expression pattern: liver, lung, intestine, kidney, urinary tract; adult expression pattern: intestine, colon, testis and thymus. |
| Induction | Induced during liver regeneration and oxidative stress. |
| Domain | Within the protein there is a domain which acts as a transcriptional activator. Insertion of a splicing sequence within it inactivates this transcriptional activity, as it is the case for isoform 4. |
| Post-translational modification | Phosphorylated in M (mitotic) phase. Phosphorylation by the checkpoint kinase CHEK2 in response to DNA damage increases the FOXM1 protein stability probably stimulating the transcription of genes involved in DNA repair. Phosphorylated by CDK1 in late S and G2 phases, creating docking sites for the POLO box domains of PLK1. Subsequently, PLK1 binds and phosphorylates FOXM1, leading to activation of transcriptional activity and subsequent enhanced expression of key mitotic regulators. Ref.6 Ref.7 |
| Sequence similarities | Contains 1 fork-head DNA-binding domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CDK6 | Q00534 | 2 | EBI-866499,EBI-295663 | |
| CTNNB1 | P35222 | 16 | EBI-866480,EBI-491549 | |
| E7 | P03129 | 3 | EBI-866499,EBI-866453 | From a different organism. |
| FOXO3 | O43524 | 2 | EBI-866480,EBI-1644164 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Isoform 1 and isoform 2 appear to be the only activators of gene transcription. Isoform 3, found in rat, does not seem to exist in human. | ||||||
| Isoform 1 (identifier: Q08050-1) Also known as: FoxM1C; FOXM1-c; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q08050-2) Also known as: FoxM1B; FOXM1-b; The sequence of this isoform differs from the canonical sequence as follows: 326-340: Missing. | ||||||
| Isoform 4 (identifier: Q08050-3) Also known as: FoxM1A; FOXM1-a; The sequence of this isoform differs from the canonical sequence as follows: 423-423: V → VFGEQVVFGYMSKFFSGDLRDFGTPITSLFNFIFLCLSV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 763 | 763 | Forkhead box protein M1 | PRO_0000091863 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| DNA binding | 235 – 327 | 93 | Fork-head | ||||||||||||||||||||||
| Compositional bias | 480 – 513 | 34 | Glu/Pro/Ser/Thr-rich | ||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||
| Modified residue | 331 | 1 | Phosphoserine Ref.8 | ||||||||||||||||||||||
| Modified residue | 376 | 1 | Phosphoserine; by CHEK2 Ref.6 | ||||||||||||||||||||||
| Modified residue | 611 | 1 | Phosphothreonine; by CDK1 Ref.7 | ||||||||||||||||||||||
| Modified residue | 620 | 1 | Phosphothreonine Ref.8 | ||||||||||||||||||||||
| Modified residue | 627 | 1 | Phosphothreonine Ref.8 | ||||||||||||||||||||||
| Modified residue | 662 | 1 | Phosphothreonine Probable | ||||||||||||||||||||||
| Modified residue | 693 | 1 | Phosphoserine; by CDK1 Ref.7 | ||||||||||||||||||||||
| Modified residue | 730 | 1 | Phosphoserine; by PLK1 Ref.7 Ref.9 | ||||||||||||||||||||||
| Modified residue | 739 | 1 | Phosphoserine; by PLK1 Ref.7 Ref.9 | ||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 326 – 340 | 15 | Missing in isoform 2. | VSP_001547 | |||||||||||||||||||||
| Alternative sequence | 423 | 1 | V → VFGEQVVFGYMSKFFSGDLR DFGTPITSLFNFIFLCLSV in isoform 4. | VSP_001548 | |||||||||||||||||||||
| Natural variant | 402 | 1 | A → E. Ref.3 Corresponds to variant rs28990715 [ dbSNP | Ensembl ]. | VAR_025239 | |||||||||||||||||||||
| Natural variant | 450 | 1 | F → L. Ref.3 Corresponds to variant rs28919868 [ dbSNP | Ensembl ]. | VAR_025240 | |||||||||||||||||||||
| Natural variant | 643 | 1 | S → P. Ref.3 Ref.4 Corresponds to variant rs3742076 [ dbSNP | Ensembl ]. | VAR_020024 | |||||||||||||||||||||
| Natural variant | 669 | 1 | P → R. Ref.3 Corresponds to variant rs28919869 [ dbSNP | Ensembl ]. | VAR_025241 | |||||||||||||||||||||
| Natural variant | 673 | 1 | P → L. Ref.3 Corresponds to variant rs28919870 [ dbSNP | Ensembl ]. | VAR_025242 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Mutagenesis | 611 | 1 | T → A: Prevents phosphorylation by CDK1 and subsequent binding of POLO box domains of PLK1; when associated with A-693. Ref.7 | ||||||||||||||||||||||
| Mutagenesis | 693 | 1 | S → A: Prevents phosphorylation by CDK1 and subsequent binding of POLO box domains of PLK1; when associated with A-611. Ref.7 | ||||||||||||||||||||||
| Mutagenesis | 730 | 1 | S → A: Prevents phosphorylation by PLK1 and impairs transcription activity; when associated with A-739. Ref.7 | ||||||||||||||||||||||
| Mutagenesis | 739 | 1 | S → A: Prevents phosphorylation by PLK1 and impairs transcription activity; when associated with A-730. Ref.7 | ||||||||||||||||||||||
| Sequence conflict | 3 | 1 | T → A in AAC63595. Ref.2 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Helix | 241 – 250 | 10 | |||||||||||||||||||||||
| Beta strand | 255 – 257 | 3 | |||||||||||||||||||||||
| Helix | 259 – 269 | 11 | |||||||||||||||||||||||
| Helix | 272 – 275 | 4 | |||||||||||||||||||||||
| Helix | 281 – 291 | 11 | |||||||||||||||||||||||
| Beta strand | 295 – 299 | 5 | |||||||||||||||||||||||
| Beta strand | 306 – 310 | 5 | |||||||||||||||||||||||
| Turn | 312 – 314 | 3 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Hepatocyte nuclear factor 3/fork head homolog 11 is expressed in proliferating epithelial and mesenchymal cells of embryonic and adult tissues." Ye H., Kelly T.F., Samadani U., Lim L., Rubio S., Overdier D.G., Roebuck K.A., Costa R.H. Mol. Cell. Biol. 17:1626-1641(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4). Tissue: Colon carcinoma. |
| [2] | "Molecular analysis of a novel winged helix protein, WIN. Expression pattern, DNA binding property, and alternative splicing within the DNA binding domain." Yao K.-M., Sha M., Lu Z., Wong G.G. J. Biol. Chem. 272:19827-19836(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Pancreatic carcinoma and Testis. |
| [3] | NIEHS SNPs program Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLU-402; LEU-450; PRO-643; ARG-669 AND LEU-673. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT PRO-643. Tissue: Lung, Ovary and Skin. |
| [5] | "Cloning of cDNAs for M-phase phosphoproteins recognized by the MPM2 monoclonal antibody and determination of the phosphorylated epitope." Westendorf J.M., Rao P.N., Gerace L. Proc. Natl. Acad. Sci. U.S.A. 91:714-718(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 543-763. Tissue: Lymphoblast. |
| [6] | "Chk2 mediates stabilization of the FoxM1 transcription factor to stimulate expression of DNA repair genes." Tan Y., Raychaudhuri P., Costa R.H. Mol. Cell. Biol. 27:1007-1016(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DNA REPAIR, PHOSPHORYLATION AT SER-376 BY CHEK2. |
| [7] | "Plk1-dependent phosphorylation of FoxM1 regulates a transcriptional programme required for mitotic progression." Fu Z., Malureanu L., Huang J., Wang W., Li H., van Deursen J.M., Tindall D.J., Chen J. Nat. Cell Biol. 10:1076-1082(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION AT THR-611; SER-693; SER-730 AND SER-739, MUTAGENESIS OF THR-611; SER-693; SER-730 AND SER-739. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-331; THR-620 AND THR-627, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-730 AND SER-739, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Structure of the FoxM1 DNA-recognition domain bound to a promoter sequence." Littler D.R., Alvarez-Fernandez M., Stein A., Hibbert R.G., Heidebrecht T., Aloy P., Medema R.H., Perrakis A. Nucleic Acids Res. 38:4527-4538(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.21 ANGSTROMS) OF 222-360 IN COMPLEX WITH PROMOTER DNA, FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U74612 mRNA. Translation: AAC51128.1. U74613 mRNA. Translation: AAC51129.1. U83113 mRNA. Translation: AAC63595.1. DQ022289 Genomic DNA. Translation: AAY26401.1. BC006192 mRNA. Translation: AAH06192.1. BC006529 mRNA. Translation: AAH06529.1. BC012863 mRNA. Translation: AAH12863.1. L16783 mRNA. Translation: AAC37541.1. | ||||||||||||
| IPI | IPI00032162. IPI00216686. IPI00401044. | ||||||||||||
| PIR | B36881. | ||||||||||||
| RefSeq | NP_001230017.1. NM_001243088.1. NP_001230018.1. NM_001243089.1. NP_068772.2. NM_021953.3. NP_973731.1. NM_202002.2. NP_973732.1. NM_202003.2. | ||||||||||||
| UniGene | Hs.239. Hs.735243. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q08050. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q08050. 11 interactions. | ||||||||||||
| MINT | MINT-107757. | ||||||||||||
| STRING | 9606.ENSP00000342307. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q08050. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 12644391. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q08050. | ||||||||||||
| PRIDE | Q08050. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 2305. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000342628; ENSP00000342307; ENSG00000111206. ENST00000359843; ENSP00000352901; ENSG00000111206. ENST00000361953; ENSP00000354492; ENSG00000111206. | ||||||||||||
| GeneID | 2305. | ||||||||||||
| KEGG | hsa:2305. | ||||||||||||
| UCSC | uc001qle.3. human. uc001qlf.3. human. uc001qlg.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 2305. | ||||||||||||
| GeneCards | GC12M002966. | ||||||||||||
| HGNC | HGNC:3818. FOXM1. | ||||||||||||
| HPA | CAB017832. HPA029974. HPA029975. HPA029976. | ||||||||||||
| MIM | 602341. gene. | ||||||||||||
| neXtProt | NX_Q08050. | ||||||||||||
| PharmGKB | PA28236. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG5025. | ||||||||||||
| HOGENOM | HOG000112633. | ||||||||||||
| HOVERGEN | HBG051652. | ||||||||||||
| KO | K09406. | ||||||||||||
| OMA | GARRKMK. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | foxm1pathway. FOXM1 transcription factor network. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q08050. | ||||||||||||
| Bgee | Q08050. | ||||||||||||
| CleanEx | HS_FOXM1. HS_MPP2. | ||||||||||||
| Genevestigator | Q08050. | ||||||||||||
| GermOnline | ENSG00000111206. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.10.10. 1 hit. | ||||||||||||
| InterPro | IPR001766. TF_fork_head. IPR018122. TF_fork_head_CS. IPR011991. WHTH_DNA-bd_dom. [Graphical view] | ||||||||||||
| Pfam | PF00250. Fork_head. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00053. FORKHEAD. | ||||||||||||
| SMART | SM00339. FH. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00657. FORK_HEAD_1. 1 hit. PS00658. FORK_HEAD_2. 1 hit. PS50039. FORK_HEAD_3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q08050. | ||||||||||||
| GenomeRNAi | 2305. | ||||||||||||
| NextBio | 9359. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | FOXM1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q08050 Secondary accession number(s): O43258 Q9BRL2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
