Reviewed,
UniProtKB/Swiss-Prot Q07866 (KLC1_HUMAN)
Last modified
October 13, 2009.
Version 94.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Kinesin light chain 1 Short name=KLC 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 573 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity. |
| Subunit structure | Oligomeric complex composed of two heavy chains and two light chains. Interacts with SPAG9 By similarity. |
| Tissue specificity | Found in a variety of tissues. Mostly abundant in brain and spine. |
| Post-translational modification | Isoform I is phosphorylated on Ser-600. Isoform J is phosphorylated on Ser-631. Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 |
| Sequence similarities | Belongs to the kinesin light chain family. Contains 6 TPR repeats. |
| Caution | It is uncertain whether Met-1 or Met-5 is the initiator. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Microtubule |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Repeat TPR repeat |
| Molecular function | Motor protein |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Cellular component | cytosol Inferred from sequence or structural similarity. Source: HGNC kinesin complexInferred from sequence or structural similarity. Source: HGNC microtubuleInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | microtubule motor activity Inferred from electronic annotation. Source: InterPro protein bindingInferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| YWHAB | P31946 | 1 | EBI-721019,EBI-359815 | |
| YWHAG | P61981 | 1 | EBI-721019,EBI-359832 | |
| YWHAZ | P63104 | 1 | EBI-721019,EBI-347088 |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. Has the potential to produce 285'919 splice forms. | |||||||||
| Isoform A (identifier: Q07866-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform C (identifier: Q07866-2) Also known as: KLC1C; R; KLC1R; The sequence of this isoform differs from the canonical sequence as follows: 551-573: GVSGRASFCGKRQQQQWPGRRHR → MRKMKLGLVN | |||||||||
| Isoform G (identifier: Q07866-3) Also known as: KLC1G; The sequence of this isoform differs from the canonical sequence as follows: 542-550: Missing. | |||||||||
| Isoform J (identifier: Q07866-4) Also known as: KLC1J; The sequence of this isoform differs from the canonical sequence as follows: 551-551: G → DGTGSLKRSGSFSKLRASIRRSSEKLVRKLKGGSSRESEPKNPG 552-573: VSGRASFCGKRQQQQWPGRRHR → MKRASSLNVLNVGGKAAEDRFQERNNCLADSRALSASHTDLAH | |||||||||
| Note: Phosphorylated on Ser-600 (Probable). Phosphorylated on Ser-631. | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 631 | 1 | S → T in AAO62555. Ref.2 | ||||||
| Isoform K (identifier: Q07866-5) Also known as: KLC1K; The sequence of this isoform differs from the canonical sequence as follows: 551-551: G → DGTGSLKRSGSFSKLRASIRRSSEKLVRKLKGGSSRESEPKNPG | |||||||||
| Isoform N (identifier: Q07866-6) Also known as: KLC1N; The sequence of this isoform differs from the canonical sequence as follows: 542-550: Missing. 551-551: G → DGTGSLKRSGSFSKLRASIRRSSEKLVRKLKGGSSRESEPKNPG 552-573: VSGRASFCGKRQQQQWPGRRHR → MKRASSLNVLNVGGKAAEDRFQERNNCLADSRALSASHTDLAH | |||||||||
| Note: Phosphorylated on Ser-591 and Ser-622 (Probable). | |||||||||
Sequence annotation (Features) | |||||||||
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 622 | 1 | S → T in AAO62551. Ref.2 | ||||||
| Isoform P (identifier: Q07866-7) Also known as: KLC1P; The sequence of this isoform differs from the canonical sequence as follows: 542-573: VSMSVEWNGGVSGRASFCGKRQQQQWPGRRHR → MKRASSLNVLNVGGKAAEDRFQERNNCLADSRALSASHTDLAH | |||||||||
| Note: Phosphorylated on Ser-547 and Ser-578 (Probable). | |||||||||
| Isoform S (identifier: Q07866-8) Also known as: KLC1S; Q; KLC1Q; The sequence of this isoform differs from the canonical sequence as follows: 542-550: Missing. 551-573: GVSGRASFCGKRQQQQWPGRRHR → MRKMKLGLVN | |||||||||
| Isoform I (identifier: Q07866-9) The sequence of this isoform differs from the canonical sequence as follows: 550-550: G → GDGTGSLKRSGSFSKLRASIRRSSEKLVRKLKGGSSRESEPKNPGMKRASSLNVLNVGGKAAEDRFQ | |||||||||
| Note: Phosphorylated on Ser-600. | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 573 | 573 | Kinesin light chain 1 | PRO_0000215092 | |||||
Regions | |||||||||
| Repeat | 213 – 246 | 34 | TPR 1 | ||||||
| Repeat | 255 – 288 | 34 | TPR 2 | ||||||
| Repeat | 297 – 330 | 34 | TPR 3 | ||||||
| Repeat | 339 – 372 | 34 | TPR 4 | ||||||
| Repeat | 381 – 414 | 34 | TPR 5 | ||||||
| Repeat | 464 – 497 | 34 | TPR 6 | ||||||
| Coiled coil | 27 – 156 | 130 | |||||||
Amino acid modifications | |||||||||
| Modified residue | 162 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 449 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 460 | 1 | Phosphoserine Ref.8 Ref.10 Ref.11 | ||||||
| Modified residue | 521 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 524 | 1 | Phosphoserine Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 542 – 573 | 32 | VSMSV…GRRHR → MKRASSLNVLNVGGKAAEDR FQERNNCLADSRALSASHTD LAH in isoform P. | VSP_008021 | |||||
| Alternative sequence | 542 – 550 | 9 | Missing in isoform G, isoform N and isoform S. | VSP_008017 | |||||
| Alternative sequence | 550 | 1 | G → GDGTGSLKRSGSFSKLRASI RRSSEKLVRKLKGGSSRESE PKNPGMKRASSLNVLNVGGK AAEDRFQ in isoform I. | VSP_023323 | |||||
| Alternative sequence | 551 – 573 | 23 | GVSGR…GRRHR → MRKMKLGLVN in isoform C and isoform S. | VSP_008018 | |||||
| Alternative sequence | 551 | 1 | G → DGTGSLKRSGSFSKLRASIR RSSEKLVRKLKGGSSRESEP KNPG in isoform J, isoform K and isoform N. | VSP_008019 | |||||
| Alternative sequence | 552 – 573 | 22 | VSGRA…GRRHR → MKRASSLNVLNVGGKAAEDR FQERNNCLADSRALSASHTD LAH in isoform J and isoform N. | VSP_008020 | |||||
Experimental info | |||||||||
| Sequence conflict | 4 | 1 | N → T in AAA16576. Ref.1 | ||||||
| Sequence conflict | 4 | 1 | N → T in AAO62548. Ref.2 | ||||||
| Sequence conflict | 4 | 1 | N → T in AAO62549. Ref.2 | ||||||
| Sequence conflict | 4 | 1 | N → T in AAO62550. Ref.2 | ||||||
| Sequence conflict | 4 | 1 | N → T in AAO62551. Ref.2 | ||||||
| Sequence conflict | 4 | 1 | N → T in AAO62553. Ref.2 | ||||||
| Sequence conflict | 4 | 1 | N → T in AAO62552. Ref.2 | ||||||
| Sequence conflict | 4 | 1 | N → T in AAO62554. Ref.2 | ||||||
| Sequence conflict | 4 | 1 | N → T in AAO62555. Ref.2 | ||||||
| Sequence conflict | 4 | 1 | N → T in AAO64641. Ref.2 | ||||||
| Sequence conflict | 4 | 1 | N → T in AAF72543. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and genetic characterization of the human kinesin light-chain (KLC) gene." Cabeza-Arvelaiz Y., Shih L.-C.N., Hardman N., Asselbergs F., Bilbe G., Schmitz A., White B., Siciliano M.J., Lachman L.B. DNA Cell Biol. 12:881-892(1993) [PubMed: 8274221] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). |
| [2] | "Alternatively spliced products of the human kinesin light chain 1 (KNS2) gene." McCart A.E., Mahony D., Rothnagel J.A. Traffic 4:576-580(2003) [PubMed: 12839500] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; C; G; I; P AND S), NUCLEOTIDE SEQUENCE [MRNA] OF 444-573 (ISOFORMS J; K AND N). Tissue: Brain, Foreskin and Liver. |
| [3] | Gerber S., Rozet J.-M., Perrault I., Ducroq D., Souied E., Munnich A., Kaplan J. Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed: 12508121] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C). Tissue: Uterus. |
| [7] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-600 (ISOFORM I), MASS SPECTROMETRY. Tissue: Epithelium. |
| [8] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-460, MASS SPECTROMETRY. Tissue: Epithelium. |
| [9] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-631 (ISOFORM J), MASS SPECTROMETRY. |
| [10] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-460, MASS SPECTROMETRY. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-460; SER-521 AND SER-524, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| L04733 mRNA. Translation: AAA16576.1. Different initiation. AY180163 mRNA. Translation: AAO62548.1. AY180164 mRNA. Translation: AAO62549.1. Different initiation. AY180165 mRNA. Translation: AAO62550.1. AY180166 mRNA. Translation: AAO62551.1. AY180168 mRNA. Translation: AAO62553.1. AY180167 mRNA. Translation: AAO62552.1. AY180169 mRNA. Translation: AAO62554.1. AY180170 mRNA. Translation: AAO62555.1. AY244715 mRNA. Translation: AAO64641.1. AF267530 AF267529 Genomic DNA. Translation: AAF72543.1. Different initiation.AL139300 Genomic DNA. No translation available. CH471061 Genomic DNA. Translation: EAW81834.1. BC008881 mRNA. Translation: AAH08881.1. BK000681 mRNA. Translation: DAA01265.1. Different initiation. BK000682 mRNA. Translation: DAA01266.1. Different initiation. BK000684 mRNA. Translation: DAA01268.1. Different initiation. BK001165 mRNA. Translation: DAA01291.1. Different initiation. BK001166 mRNA. Translation: DAA01292.1. Different initiation. BK001169 mRNA. Translation: DAA01295.1. Different initiation. BK001170 mRNA. Translation: DAA01296.1. Different initiation. BK001171 mRNA. Translation: DAA01297.1. Different initiation. | |
| IPI | IPI00020096. IPI00337465. IPI00394906. IPI00397666. IPI00398708. IPI00412642. IPI00472303. IPI00479424. IPI00921532. |
| PIR | I53013. |
| RefSeq | NP_001123579.1. NP_005543.2. NP_891553.2. |
| UniGene | Hs.20107 Hs.657678 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q07866. 5 interactions. |
| STRING | Q07866. |
PTM databases | |
| PhosphoSite | Q07866. |
Proteomic databases | |
| PRIDE | Q07866. |
Genome annotation databases | |
| Ensembl | ENST00000246489; ENSP00000246489; ENSG00000126214; Homo sapiens. [Genome view] ENST00000247618; ENSP00000247618; ENSG00000126214; Homo sapiens. [Genome view] ENST00000334553; ENSP00000334523; ENSG00000126214; Homo sapiens. [Genome view] ENST00000347839; ENSP00000334618; ENSG00000126214; Homo sapiens. [Genome view] ENST00000348520; ENSP00000341154; ENSG00000126214; Homo sapiens. [Genome view] ENST00000380038; ENSP00000369377; ENSG00000126214; Homo sapiens. [Genome view] ENST00000389744; ENSP00000374394; ENSG00000126214; Homo sapiens. [Genome view] ENST00000409074; ENSP00000386485; ENSG00000126214; Homo sapiens. [Genome view] ENST00000440963; ENSP00000388067; ENSG00000126214; Homo sapiens. [Genome view] ENST00000443396; ENSP00000402779; ENSG00000126214; Homo sapiens. [Genome view] ENST00000445352; ENSP00000412693; ENSG00000126214; Homo sapiens. [Genome view] ENST00000452929; ENSP00000414982; ENSG00000126214; Homo sapiens. [Genome view] ENST00000458117; ENSP00000408525; ENSG00000126214; Homo sapiens. [Genome view] |
| GeneID | 3831. |
| KEGG | hsa:3831. |
| UCSC | uc001ynm.1. human. uc001ynn.1. human. uc001yno.1. human. |
Organism-specific databases | |
| CTD | 3831. |
| GeneCards | GC14P103167. |
| H-InvDB | HIX0012004. |
| HGNC | HGNC:6387. KLC1. |
| HPA | CAB009798. |
| MIM | 600025. gene. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q07866. |
Gene expression databases | |
| ArrayExpress | Q07866. |
| Bgee | Q07866. |
| Genevestigator | Q07866. |
| GermOnline | ENSG00000126214. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002151. Kinesin_light. IPR015792. Kinesin_light_repeat. IPR015390. Rabaptin_Rab5-bd. IPR001440. TPR-1. IPR011990. TPR-like_helical. IPR013026. TPR_region. IPR019734. TPR_repeat. [Graphical view] |
| Gene3D | G3DSA:1.25.40.10. TPR-like_helical. 1 hit. |
| Pfam | PF09311. Rab5-bind. 1 hit. PF00515. TPR_1. 5 hits. [Graphical view] |
| PRINTS | PR00381. KINESINLIGHT. |
| SMART | SM00028. TPR. 5 hits. [Graphical view] |
| PROSITE | PS01160. KINESIN_LIGHT. 4 hits. PS50005. TPR. 6 hits. PS50293. TPR_REGION. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 15055. |
| SOURCE | Search... |
Entry information
| Entry name | KLC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q07866 Secondary accession number(s): A6NF62 Q96H62 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


