Q07816 (B2CL1_CHICK) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bcl-2-like protein 1 Short name=Bcl2-L-1 Alternative name(s): Apoptosis regulator Bcl-X | ||||
| Gene names |
| ||||
| Organism | Gallus gallus (Chicken) [Reference proteome] | ||||
| Taxonomic identifier | 9031 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Archosauria › Dinosauria › Saurischia › Theropoda › Coelurosauria › Aves › Neognathae › Galliformes › Phasianidae › Phasianinae › Gallus![]() |
Protein attributes
| Sequence length | 229 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Dominant regulator of apoptotic cell death. The long form displays cell death repressor activity, whereas the short isoform promotes apoptosis. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis By similarity. |
| Subcellular location | Mitochondrion membrane; Single-pass membrane protein By similarity. Nucleus membrane; Single-pass membrane protein; Cytoplasmic side By similarity. Cytoplasm › cytoskeleton › centrosome By similarity. Note: Mitochondrial membranes and perinuclear envelope By similarity. |
| Tissue specificity | Highest expression in organs with lymphoid development. |
| Domain | The BH4 motif seems to be involved in the anti-apoptotic function. Intact BH1 and BH2 motifs are required for anti-apoptotic activity By similarity. |
| Sequence similarities | Belongs to the Bcl-2 family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: Q07816-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: Q07816-2) The sequence of this isoform differs from the canonical sequence as follows: 185-229: ERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK → VRTALP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 229 | 229 | Bcl-2-like protein 1 | PRO_0000143061 | |||||
Regions | |||||||||
| Transmembrane | 206 – 223 | 18 | Helical; Potential | ||||||
| Motif | 4 – 24 | 21 | BH4 | ||||||
| Motif | 82 – 96 | 15 | BH3 | ||||||
| Motif | 125 – 144 | 20 | BH1 | ||||||
| Motif | 176 – 191 | 16 | BH2 | ||||||
Natural variations | |||||||||
| Alternative sequence | 185 – 229 | 45 | ERFVD…LLSRK → VRTALP in isoform Short. | VSP_000514 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "bcl-x, a bcl-2-related gene that functions as a dominant regulator of apoptotic cell death." Boise L.H., Gonzalez-Garcia M., Postema C.E., Ding L., Lindsten T., Turka L.A., Mao X., Nunez G., Thompson C.B. Cell 74:597-608(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM SHORT). |
| [2] | "Differential expression of bcl-2 and bcl-x during chicken spermatogenesis." Vilagrasa X., Mezquita C., Mezquita J. Mol. Reprod. Dev. 47:26-29(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG). Strain: Hubbard White Mountain. Tissue: Testis. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Z23110 Genomic DNA. Translation: CAA80657.1. U26645 mRNA. Translation: AAB07677.1. |
| IPI | IPI00576590. IPI00594932. |
| PIR | A47537. |
| RefSeq | NP_001020475.1. NM_001025304.1. |
| UniGene | Gga.4944. |
3D structure databases | |
| ProteinModelPortal | Q07816. |
| SMR | Q07816. Positions 1-204. |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | Q07816. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSGALT00000010073; ENSGALP00000010059; ENSGALG00000006211. |
| GeneID | 373954. |
| KEGG | gga:373954. |
Organism-specific databases | |
| CTD | 598. |
Phylogenomic databases | |
| eggNOG | NOG300479. |
| GeneTree | ENSGT00530000062935. |
| HOGENOM | HOG000056452. |
| InParanoid | Q07816. |
| KO | K04570. |
| OMA | NGSPSWH. |
Gene expression databases | |
| ArrayExpress | Q07816. |
Family and domain databases | |
| InterPro | IPR013279. Apop_reg_BclX. IPR002475. Bcl2-like. IPR004725. Bcl2/BclX. IPR020717. Bcl2_BH1_motif_CS. IPR020726. Bcl2_BH2_motif_CS. IPR020728. Bcl2_BH3_motif_CS. IPR003093. Bcl2_BH4. IPR020731. Bcl2_BH4_motif_CS. IPR026298. Blc2_fam. [Graphical view] |
| PANTHER | PTHR11256. PTHR11256. 1 hit. PTHR11256:SF12. PTHR11256:SF12. 1 hit. |
| Pfam | PF00452. Bcl-2. 1 hit. PF02180. BH4. 1 hit. [Graphical view] |
| PRINTS | PR01864. APOPREGBCLX. PR01862. BCL2FAMILY. |
| TIGRFAMs | TIGR00865. bcl-2. 1 hit. |
| PROSITE | PS50062. BCL2_FAMILY. 1 hit. PS01080. BH1. 1 hit. PS01258. BH2. 1 hit. PS01259. BH3. 1 hit. PS01260. BH4_1. 1 hit. PS50063. BH4_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 20813485. |
Entry information
| Entry name | B2CL1_CHICK | ||||||||
| Accession | Primary (citable) accession number: Q07816 Secondary accession number(s): Q98908 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
