Q07812 (BAX_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 16, 2012.
Version 134.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Apoptosis regulator BAX Alternative name(s): Bcl-2-like protein 4 Short name=Bcl2-L-4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 192 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis. Ref.1 Ref.4 Ref.12 Ref.17 Ref.24 Ref.25 |
| Subunit structure | Homodimer. Forms higher oligomers under stress conditions. Interacts with BCL2L11. Interaction with BCL2L11 promotes BAX oligomerization and association with mitochondrial membranes, with subsequent release of cytochrome c. Forms heterodimers with BCL2, E1B 19K protein, BCL2L1 isoform Bcl-X(L), BCL2L2, MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). Interacts with RNF144B, which regulates the ubiquitin-dependent stability of BAX. Interacts with CLU under stress conditions that cause a conformation change leading to BAX oligomerization and association with mitochondria. Does not interact with CLU in unstressed cells. Interacts with FAIM2/LFG2. Ref.1 Ref.4 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.20 Ref.22 Ref.24 Ref.25 |
| Subcellular location | Isoform Alpha: Mitochondrion membrane; Single-pass membrane protein. Cytoplasm. Note: Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane. Ref.1 Ref.13 Ref.16 Ref.17 Ref.22 Isoform Beta: Cytoplasm Ref.1 Ref.13 Ref.16 Ref.17 Ref.22. Isoform Gamma: Cytoplasm Ref.1 Ref.13 Ref.16 Ref.17 Ref.22. Isoform Delta: Cytoplasm Potential Ref.1 Ref.13 Ref.16 Ref.17 Ref.22. |
| Tissue specificity | Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines. Ref.4 Ref.5 |
| Domain | Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family By similarity. |
| Sequence similarities | Belongs to the Bcl-2 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 15 | EBI-516580,EBI-516580 | ||
| BCL2 | P10415 | 5 | EBI-516580,EBI-77694 | |
| BCL2L1 | Q07817-1 | 11 | EBI-516580,EBI-287195 | |
| Bid | P70444 | 2 | EBI-516580,EBI-2128640 | From a different organism. |
| MCL1 | Q07820 | 3 | EBI-516580,EBI-1003422 | |
| SH3GLB1 | Q9Y371-1 | 2 | EBI-516580,EBI-5291808 | |
| tom-40 | P24391 | 2 | EBI-516580,EBI-1791540 | From a different organism. |
| XRCC6 | P12956 | 2 | EBI-516580,EBI-353208 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha (identifier: Q07812-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Beta (identifier: Q07812-2) The sequence of this isoform differs from the canonical sequence as follows: 159-192: DGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG → VRLLKPPHPH...VVYNAFSLRV | ||||||
| Isoform Gamma (identifier: Q07812-3) The sequence of this isoform differs from the canonical sequence as follows: 12-41: GPTSSEQIMKTGALLLQGFIQDRAGRMGGE → VSSRIEQGEWGGRHPSWPWTRCLRMRPPRS 42-192: Missing. | ||||||
| Isoform Delta (identifier: Q07812-4) The sequence of this isoform differs from the canonical sequence as follows: 30-78: Missing. | ||||||
| Isoform Epsilon (identifier: Q07812-5) The sequence of this isoform differs from the canonical sequence as follows: 125-192: LCTKVPELIR...ASLTIWKKMG → GVKWRDLGSL...YRPCAPRCRN | ||||||
| Isoform Zeta (identifier: Q07812-6) The sequence of this isoform differs from the canonical sequence as follows: 1-78: Missing. | ||||||
| Isoform Psi (identifier: Q07812-7) The sequence of this isoform differs from the canonical sequence as follows: 1-19: Missing. | ||||||
| Isoform Sigma (identifier: Q07812-8) The sequence of this isoform differs from the canonical sequence as follows: 159-171: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 192 | 192 | Apoptosis regulator BAX | PRO_0000143053 | |||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||
| Transmembrane | 172 – 192 | 21 | Helical; Potential | ||||||||||||||||||||||||||||||
| Motif | 59 – 73 | 15 | BH3 | ||||||||||||||||||||||||||||||
| Motif | 98 – 118 | 21 | BH1 | ||||||||||||||||||||||||||||||
| Motif | 150 – 165 | 16 | BH2 | ||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.19 | ||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 78 | 78 | Missing in isoform Zeta. | VSP_031239 | |||||||||||||||||||||||||||||
| Alternative sequence | 1 – 19 | 19 | Missing in isoform Psi. | VSP_031238 | |||||||||||||||||||||||||||||
| Alternative sequence | 12 – 41 | 30 | GPTSS…RMGGE → VSSRIEQGEWGGRHPSWPWT RCLRMRPPRS in isoform Gamma. | VSP_031234 | |||||||||||||||||||||||||||||
| Alternative sequence | 30 – 78 | 49 | Missing in isoform Delta. | VSP_031235 | |||||||||||||||||||||||||||||
| Alternative sequence | 42 – 192 | 151 | Missing in isoform Gamma. | VSP_031236 | |||||||||||||||||||||||||||||
| Alternative sequence | 125 – 192 | 68 | LCTKV…WKKMG → GVKWRDLGSLQPLPPGFKRF TCLSIPRSWDYRPCAPRCRN in isoform Epsilon. | VSP_031240 | |||||||||||||||||||||||||||||
| Alternative sequence | 159 – 192 | 34 | DGLLS…WKKMG → VRLLKPPHPHHRALTTAPAP PSLPPATPLGPWAFWSRSQW CPLPIFRSSDVVYNAFSLRV in isoform Beta. | VSP_031237 | |||||||||||||||||||||||||||||
| Alternative sequence | 159 – 171 | 13 | Missing in isoform Sigma. | VSP_037475 | |||||||||||||||||||||||||||||
| Natural variant | 11 | 1 | G → E in a plasmacytoma cell line. Ref.26 | VAR_013575 | |||||||||||||||||||||||||||||
| Natural variant | 39 | 1 | G → R. Corresponds to variant rs36017265 [ dbSNP | Ensembl ]. | VAR_047053 | |||||||||||||||||||||||||||||
| Natural variant | 67 | 1 | G → R in a T-cell acute lymphoblastic leukemia cell line; loss of heterodimerization with Bcl-2 or Bcl-X(L). Ref.11 Ref.26 | VAR_007809 | |||||||||||||||||||||||||||||
| Natural variant | 108 | 1 | G → V in a Burkitt lymphoma; loss of homodimerization. Ref.11 Ref.26 | VAR_013576 | |||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||
| Mutagenesis | 21 | 1 | K → E: Reduces interaction with BCL2L11, homooligomerization and triggering of apoptosis. Ref.24 | ||||||||||||||||||||||||||||||
| Mutagenesis | 74 | 1 | M → D or E: Strongly reduced interaction with MCL1, BCL2, BCL2L1 and BCL2L2. No effect on cytochrome c release and subsequent apoptosis triggered by etoposide. Ref.25 | ||||||||||||||||||||||||||||||
| Mutagenesis | 184 | 1 | S → D, E, H or K: Constitutive cytoplasmic location. Ref.13 | ||||||||||||||||||||||||||||||
| Mutagenesis | 184 | 1 | S → V: Constitutive mitochondrial location. Ref.13 | ||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||
| Beta strand | 10 – 14 | 5 | |||||||||||||||||||||||||||||||
| Helix | 16 – 35 | 20 | |||||||||||||||||||||||||||||||
| Beta strand | 43 – 45 | 3 | |||||||||||||||||||||||||||||||
| Helix | 54 – 71 | 18 | |||||||||||||||||||||||||||||||
| Helix | 74 – 80 | 7 | |||||||||||||||||||||||||||||||
| Helix | 88 – 99 | 12 | |||||||||||||||||||||||||||||||
| Beta strand | 101 – 104 | 4 | |||||||||||||||||||||||||||||||
| Helix | 108 – 127 | 20 | |||||||||||||||||||||||||||||||
| Helix | 130 – 146 | 17 | |||||||||||||||||||||||||||||||
| Turn | 147 – 149 | 3 | |||||||||||||||||||||||||||||||
| Helix | 150 – 154 | 5 | |||||||||||||||||||||||||||||||
| Helix | 159 – 164 | 6 | |||||||||||||||||||||||||||||||
| Helix | 171 – 188 | 18 | |||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Bcl-2 heterodimerizes in vivo with a conserved homolog, Bax, that accelerates programmed cell death." Oltvai Z.N., Milliman C.L., Korsmeyer S.J. Cell 74:609-619(1993) [PubMed: 8358790] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA AND GAMMA), FUNCTION, SUBUNIT, SUBCELLULAR LOCATION. Tissue: B-cell. |
| [2] | "Mapping of the human BAX gene to chromosome 19q13.3-q13.4 and isolation of a novel alternatively spliced transcript, BAX delta." Apte S.S., Mattei M.-G., Olsen B.R. Genomics 26:592-594(1995) [PubMed: 7607685] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM DELTA). |
| [3] | "Identification and characterization of baxepsilon, a novel bax variant missing the BH2 and the transmembrane domains." Shi B., Triebe D., Kajiji S., Iwata K.K., Bruskin A., Mahajna J. Biochem. Biophys. Res. Commun. 254:779-785(1999) [PubMed: 9920818] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EPSILON). Tissue: Brain. |
| [4] | "Characterization of Bax-sigma, a cell death-inducing isoform of Bax." Schmitt E., Paquet C., Beauchemin M., Dever-Bertrand J., Bertrand R. Biochem. Biophys. Res. Commun. 270:868-879(2000) [PubMed: 10772918] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND SIGMA), FUNCTION, INTERACTION WITH BCL2A1 AND BCL2L1, TISSUE SPECIFICITY. |
| [5] | "The expression of a new variant of the pro-apoptotic molecule Bax, Baxpsi, is correlated with an increased survival of glioblastoma multiforme patients." Cartron P.F., Oliver L., Martin S., Moreau C., LeCabellec M.T., Jezequel P., Meflah K., Vallette F.M. Hum. Mol. Genet. 11:675-687(2002) [PubMed: 11912183] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSI), TISSUE SPECIFICITY. |
| [6] | "Bax mRNA splice variant lacking exons 2 and 3." Perez R.P., Sanville H. Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ZETA). Tissue: Ovarian carcinoma. |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). |
| [8] | NIEHS SNPs program Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). Tissue: Skin. |
| [11] | "Bax mutations in cell lines derived from hematological malignancies." Meijerink J.P.P., Smetsers T.F.C.M., Sloetjes A.W., Linders E.H.P., Mensink E.J.B.M. Leukemia 9:1828-1832(1995) [PubMed: 7475270] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 63-77 AND 98-118, VARIANTS ARG-67 AND VAL-108. |
| [12] | "A conserved domain in Bak, distinct from BH1 and BH2, mediates cell death and protein binding functions." Chittenden T., Flemington C., Houghton A.B., Ebb R.G., Gallo G.J., Elangovan B., Chinnadurai G., Lutz R.J. EMBO J. 14:5589-5596(1995) [PubMed: 8521816] [Abstract] Cited for: MUTAGENESIS, FUNCTION OF BH3 MOTIF. |
| [13] | "Conformation of the Bax C-terminus regulates subcellular location and cell death." Nechushtan A., Smith C.L., Hsu Y.-T., Youle R.J. EMBO J. 18:2330-2341(1999) [PubMed: 10228148] [Abstract] Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF SER-184. |
| [14] | "Molecular cloning and characterization of Bif-1. A novel Src homology 3 domain-containing protein that associates with Bax." Cuddeback S.M., Yamaguchi H., Komatsu K., Miyashita T., Yamada M., Wu C., Singh S., Wang H.-G. J. Biol. Chem. 276:20559-20565(2001) [PubMed: 11259440] [Abstract] Cited for: INTERACTION WITH SH3GLB1. |
| [15] | "Humanin peptide suppresses apoptosis by interfering with Bax activation." Guo B., Zhai D., Cabezas E., Welsh K., Nouraini S., Satterthwait A.C., Reed J.C. Nature 423:456-461(2003) [PubMed: 12732850] [Abstract] Cited for: INTERACTION WITH HN. |
| [16] | "JNK promotes Bax translocation to mitochondria through phosphorylation of 14-3-3 proteins." Tsuruta F., Sunayama J., Mori Y., Hattori S., Shimizu S., Tsujimoto Y., Yoshioka K., Masuyama N., Gotoh Y. EMBO J. 23:1889-1899(2004) [PubMed: 15071501] [Abstract] Cited for: INTERACTION WITH SFN AND YWHAZ, SUBCELLULAR LOCATION. |
| [17] | "Clusterin inhibits apoptosis by interacting with activated Bax." Zhang H., Kim J.K., Edwards C.A., Xu Z., Taichman R., Wang C.Y. Nat. Cell Biol. 7:909-915(2005) [PubMed: 16113678] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH CLU. |
| [18] | "Sequence analysis shows that Lifeguard belongs to a new evolutionarily conserved cytoprotective family." Reimers K., Choi C.Y., Mau-Thek E., Vogt P.M. Int. J. Mol. Med. 18:729-734(2006) [PubMed: 16964429] [Abstract] Cited for: INTERACTION WITH FAIM2/LFG2. |
| [19] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [20] | "IBRDC2, an IBR-type E3 ubiquitin ligase, is a regulatory factor for Bax and apoptosis activation." Benard G., Neutzner A., Peng G., Wang C., Livak F., Youle R.J., Karbowski M. EMBO J. 29:1458-1471(2010) [PubMed: 20300062] [Abstract] Cited for: INTERACTION WITH RNF144B. |
| [21] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [22] | "Structure of Bax: coregulation of dimer formation and intracellular localization." Suzuki M., Youle R.J., Tjandra N. Cell 103:645-654(2000) [PubMed: 11106734] [Abstract] Cited for: STRUCTURE BY NMR, SUBCELLULAR LOCATION, SUBUNIT. |
| [23] | "Elucidation of some Bax conformational changes through crystallization of an antibody-peptide complex." Peyerl F.W., Dai S., Murphy G.A., Crawford F., White J., Marrack P., Kappler J.W. Cell Death Differ. 14:447-452(2007) [PubMed: 16946732] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 13-19 IN COMPLEX WITH ANTIBODY FRAGMENT. |
| [24] | "BAX activation is initiated at a novel interaction site." Gavathiotis E., Suzuki M., Davis M.L., Pitter K., Bird G.H., Katz S.G., Tu H.C., Kim H., Cheng E.H., Tjandra N., Walensky L.D. Nature 455:1076-1081(2008) [PubMed: 18948948] [Abstract] Cited for: STRUCTURE BY NMR IN COMPLEX WITH BCL2L11, FUNCTION, SUBUNIT, MUTAGENESIS OF LYS-21, INTERACTION WITH BCL2L11. |
| [25] | "Mutation to Bax beyond the BH3 domain disrupts interactions with pro-survival proteins and promotes apoptosis." Czabotar P.E., Lee E.F., Thompson G.V., Wardak A.Z., Fairlie W.D., Colman P.M. J. Biol. Chem. 286:7123-7131(2011) [PubMed: 21199865] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.49 ANGSTROMS) OF 48-81 IN COMPLEXES WITH BCL2L1 AND MCL1, INTERACTION WITH MCL1; BCL2; BCL2L1 AND BCL2L2, FUNCTION, MUTAGENESIS OF MET-74. |
| [26] | "Hematopoietic malignancies demonstrate loss-of-function mutations of BAX." Meijerink J.P.P., Mensink E.J.B.M., Wang K., Sedlak T.W., Sloetjes A.W., de Witte T., Waksman G., Korsmeyer S.J. Blood 91:2991-2997(1998) [PubMed: 9531611] [Abstract] Cited for: VARIANTS GLU-11; ARG-67 AND VAL-108. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L22473 mRNA. Translation: AAA03619.1. L22474 mRNA. Translation: AAA03620.1. L22475 mRNA. Translation: AAA03621.1. U19599 mRNA. Translation: AAC50142.1. AF007826 mRNA. Translation: AAD22706.1. AF247393 mRNA. Translation: AAF71267.1. AJ417988 mRNA. Translation: CAD10744.1. AF250190 mRNA. Translation: AAF82094.1. AK291076 mRNA. Translation: BAF83765.1. AY217036 Genomic DNA. Translation: AAO22992.1. CH471177 Genomic DNA. Translation: EAW52418.1. CH471177 Genomic DNA. Translation: EAW52417.1. BC014175 mRNA. Translation: AAH14175.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00071059. IPI00439209. IPI00443773. IPI00444945. IPI00445503. IPI00845474. IPI00885178. IPI00885203. | ||||||||||||||||||||||||||||||||||||
| PIR | A47538. B47538. C47538. I38921. JC7255. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_004315.1. NM_004324.3. NP_620116.1. NM_138761.3. NP_620118.1. NM_138763.3. NP_620119.2. NM_138764.4. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.624291. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q07812. | ||||||||||||||||||||||||||||||||||||
| SMR | Q07812. Positions 1-192. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| DIP | DIP-232N. | ||||||||||||||||||||||||||||||||||||
| IntAct | Q07812. 12 interactions. | ||||||||||||||||||||||||||||||||||||
| MINT | MINT-134330. | ||||||||||||||||||||||||||||||||||||
| STRING | Q07812. | ||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||
| TCDB | 1.A.21.1.2. bcl-2 (Bcl-2) family. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q07812. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 728945. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PRIDE | Q07812. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| DNASU | 581. | ||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000345358; ENSP00000263262; ENSG00000087088. | ||||||||||||||||||||||||||||||||||||
| GeneID | 581. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:581. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc002plf.1. human. uc002plj.3. human. uc002plk.3. human. uc002pll.3. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 581. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC19P049458. | ||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0015309. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:959. BAX. | ||||||||||||||||||||||||||||||||||||
| HPA | CAB004206. HPA027878. | ||||||||||||||||||||||||||||||||||||
| MIM | 600040. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q07812. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA25269. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | NOG46695. | ||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00530000062935. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG003606. | ||||||||||||||||||||||||||||||||||||
| KO | K02159. | ||||||||||||||||||||||||||||||||||||
| OMA | FYFATKL. | ||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG49CQ8P. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. ceramidepathway. Ceramide signaling pathway. hdac_classiii_pathway. Signaling events mediated by HDAC Class III. syndecan_2_pathway. Syndecan-2-mediated signaling events. | ||||||||||||||||||||||||||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q07812. | ||||||||||||||||||||||||||||||||||||
| Bgee | Q07812. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_BAX. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | Q07812. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000087088. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| InterPro | IPR002475. Bcl2-like_apoptosis. IPR000712. Bcl2_BH. IPR020717. Bcl2_BH1_motif_CS. IPR020726. Bcl2_BH2_motif_CS. IPR020728. Bcl2_BH3_motif_CS. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Pfam | PF00452. Bcl-2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PRINTS | PR01862. BCL2FAMILY. | ||||||||||||||||||||||||||||||||||||
| SMART | SM00337. BCL. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS50062. BCL2_FAMILY. 1 hit. PS01080. BH1. 1 hit. PS01258. BH2. 1 hit. PS01259. BH3. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q07812. | ||||||||||||||||||||||||||||||||||||
| NextBio | 2371. | ||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | Q07812. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | BAX_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q07812 Secondary accession number(s): A8K4W1 Q9UQD6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with