Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q07763

- CD244_MOUSE

UniProt

Q07763 - CD244_MOUSE

Protein

Natural killer cell receptor 2B4

Gene

Cd244

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 107 (01 Oct 2014)
      Sequence version 3 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Modulates other receptor-ligand interactions to enhance leukocyte activation By similarity. CD244/2B4 is the only heterophilic receptor of SLAM family.By similarity

    GO - Molecular functioni

    1. protein binding Source: MGI
    2. receptor activity Source: InterPro

    Keywords - Molecular functioni

    Receptor

    Enzyme and pathway databases

    ReactomeiREACT_225233. Cell surface interactions at the vascular wall.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Natural killer cell receptor 2B4
    Alternative name(s):
    NK cell type I receptor protein 2B4
    Short name:
    NKR2B4
    Non-MHC restricted killing associated
    SLAM family member 4
    Short name:
    SLAMF4
    Signaling lymphocytic activation molecule 4
    CD_antigen: CD244
    Gene namesi
    Name:Cd244
    Synonyms:2b4, Nmrk
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 1

    Organism-specific databases

    MGIiMGI:109294. Cd244.

    Subcellular locationi

    GO - Cellular componenti

    1. external side of plasma membrane Source: MGI
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1919Sequence AnalysisAdd
    BLAST
    Chaini20 – 397378Natural killer cell receptor 2B4PRO_0000014669Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi22 ↔ 1192 Publications
    Glycosylationi78 – 781N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi145 – 1451N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi154 ↔ 196By similarity
    Glycosylationi161 – 1611N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi178 – 1781N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi197 – 1971N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi206 – 2061N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi210 – 2101N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    N-linked glycosylation is essential for the binding to its ligand CD48. Also O-glycosylated, in contrast, O-linked sialylation has a negative impact on ligand binding By similarity.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PRIDEiQ07763.

    PTM databases

    PhosphoSiteiQ07763.

    Expressioni

    Gene expression databases

    BgeeiQ07763.
    CleanExiMM_CD244.
    GenevestigatoriQ07763.

    Interactioni

    Subunit structurei

    Interacts with CD48. Following phosphorylation, it is able to recruit PTPN11/SHP-2 and SH2D1A/SAP. Binding of SH2D1A/SAP to CD244 prevents its association with PTPN11/SHP-2 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi201792. 2 interactions.
    STRINGi10090.ENSMUSP00000004829.

    Structurei

    Secondary structure

    1
    397
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi25 – 317
    Beta strandi37 – 393
    Beta strandi50 – 567
    Beta strandi60 – 623
    Beta strandi63 – 7311
    Beta strandi76 – 783
    Helixi79 – 835
    Beta strandi85 – 873
    Turni89 – 913
    Beta strandi94 – 985
    Helixi101 – 1033
    Beta strandi105 – 1128
    Beta strandi117 – 12711

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1Z2KNMR-A21-129[»]
    2PTTX-ray1.63B19-129[»]
    2PTUX-ray2.38A/B/C/D19-129[»]
    ProteinModelPortaliQ07763.
    SMRiQ07763. Positions 21-128.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ07763.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini20 – 226207ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini248 – 397150CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei227 – 24721HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini22 – 129108Ig-like 1Add
    BLAST
    Domaini131 – 21585Ig-like 2Add
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG46473.
    GeneTreeiENSGT00510000049238.
    HOVERGENiHBG050850.
    InParanoidiQ3UV86.
    KOiK06582.
    OMAiHTYTCNV.
    OrthoDBiEOG7QVM45.
    TreeFamiTF334964.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    InterProiIPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR024304. NK_rcpt_2B4.
    IPR024303. NK_rcpt_2B4_Ig_dom.
    IPR015631. SLAM_fam_rcpts.
    [Graphical view]
    PANTHERiPTHR12080. PTHR12080. 1 hit.
    PTHR12080:SF3. PTHR12080:SF3. 1 hit.
    PfamiPF11465. Receptor_2B4. 1 hit.
    [Graphical view]
    SMARTiSM00409. IG. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q07763-1) [UniParc]FASTAAdd to Basket

    Also known as: m2B4L

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLGQAVLFTT FLLLRAHQGQ DCPDSSEEVV GVSGKPVQLR PSNIQTKDVS    50
    VQWKKTEQGS HRKIEILNWY NDGPSWSNVS FSDIYGFDYG DFALSIKSAK 100
    LQDSGHYLLE ITNTGGKVCN KNFQLLILDH VETPNLKAQW KPWTNGTCQL 150
    FLSCLVTKDD NVSYALYRGS TLISNQRNST HWENQIDASS LHTYTCNVSN 200
    RASWANHTLN FTHGCQSVPS NFRFLPFGVI IVILVTLFLG AIICFCVWTK 250
    KRKQLQFSPK EPLTIYEYVK DSRASRDQQG CSRASGSPSA VQEDGRGQRE 300
    LDRRVSEVLE QLPQQTFPGD RGTMYSMIQC KPSDSTSQEK CTVYSVVQPS 350
    RKSGSKKRNQ NSSLSCTVYE EVGNPWLKAH NPARLSRREL ENFDVYS 397
    Length:397
    Mass (Da):44,836
    Last modified:July 27, 2011 - v3
    Checksum:i0E2F0D946F7B63A7
    GO
    Isoform 2 (identifier: Q07763-2) [UniParc]FASTAAdd to Basket

    Also known as: m2B4S

    The sequence of this isoform differs from the canonical sequence as follows:
         309-340: LEQLPQQTFPGDRGTMYSMIQCKPSDSTSQEK → MFSSLLAFLLHQFPGSTQRGKEKRERAEKNGK
         341-397: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:340
    Mass (Da):38,397
    Checksum:i0D5275A1A354FC1E
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti38 – 381Q → P in AAF91290. (PubMed:10941850)Curated
    Sequence conflicti156 – 1561V → A in AAF91290. (PubMed:10941850)Curated
    Sequence conflicti166 – 1661L → FW in AAA16353. (PubMed:8228228)Curated
    Sequence conflicti362 – 3621S → Y in AAA16353. (PubMed:8228228)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei309 – 34032LEQLP…TSQEK → MFSSLLAFLLHQFPGSTQRG KEKRERAEKNGK in isoform 2. 1 PublicationVSP_010401Add
    BLAST
    Alternative sequencei341 – 39757Missing in isoform 2. 1 PublicationVSP_010402Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L19057 mRNA. Translation: AAA16353.1.
    AF234831 mRNA. Translation: AAF91290.1.
    AF082803 mRNA. Translation: AAC34859.1.
    AK137505 mRNA. Translation: BAE23386.1.
    CCDSiCCDS35778.1. [Q07763-1]
    PIRiI49443.
    RefSeqiNP_061199.2. NM_018729.2. [Q07763-1]
    UniGeneiMm.2299.

    Genome annotation databases

    EnsembliENSMUST00000004829; ENSMUSP00000004829; ENSMUSG00000004709. [Q07763-1]
    GeneIDi18106.
    KEGGimmu:18106.
    UCSCiuc007dos.1. mouse. [Q07763-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L19057 mRNA. Translation: AAA16353.1 .
    AF234831 mRNA. Translation: AAF91290.1 .
    AF082803 mRNA. Translation: AAC34859.1 .
    AK137505 mRNA. Translation: BAE23386.1 .
    CCDSi CCDS35778.1. [Q07763-1 ]
    PIRi I49443.
    RefSeqi NP_061199.2. NM_018729.2. [Q07763-1 ]
    UniGenei Mm.2299.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1Z2K NMR - A 21-129 [» ]
    2PTT X-ray 1.63 B 19-129 [» ]
    2PTU X-ray 2.38 A/B/C/D 19-129 [» ]
    ProteinModelPortali Q07763.
    SMRi Q07763. Positions 21-128.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 201792. 2 interactions.
    STRINGi 10090.ENSMUSP00000004829.

    PTM databases

    PhosphoSitei Q07763.

    Proteomic databases

    PRIDEi Q07763.

    Protocols and materials databases

    DNASUi 18106.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000004829 ; ENSMUSP00000004829 ; ENSMUSG00000004709 . [Q07763-1 ]
    GeneIDi 18106.
    KEGGi mmu:18106.
    UCSCi uc007dos.1. mouse. [Q07763-1 ]

    Organism-specific databases

    CTDi 51744.
    MGIi MGI:109294. Cd244.

    Phylogenomic databases

    eggNOGi NOG46473.
    GeneTreei ENSGT00510000049238.
    HOVERGENi HBG050850.
    InParanoidi Q3UV86.
    KOi K06582.
    OMAi HTYTCNV.
    OrthoDBi EOG7QVM45.
    TreeFami TF334964.

    Enzyme and pathway databases

    Reactomei REACT_225233. Cell surface interactions at the vascular wall.

    Miscellaneous databases

    EvolutionaryTracei Q07763.
    NextBioi 293289.
    PROi Q07763.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q07763.
    CleanExi MM_CD244.
    Genevestigatori Q07763.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    InterProi IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR024304. NK_rcpt_2B4.
    IPR024303. NK_rcpt_2B4_Ig_dom.
    IPR015631. SLAM_fam_rcpts.
    [Graphical view ]
    PANTHERi PTHR12080. PTHR12080. 1 hit.
    PTHR12080:SF3. PTHR12080:SF3. 1 hit.
    Pfami PF11465. Receptor_2B4. 1 hit.
    [Graphical view ]
    SMARTi SM00409. IG. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of the 2B4 gene encoding a molecule associated with non-MHC-restricted killing mediated by activated natural killer cells and T cells."
      Mathew P.A., Garni-Wagner B.A., Land K., Takashima A., Stoneman E., Bennett M., Kumar V.
      J. Immunol. 151:5328-5337(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: C57BL/6.
    2. "Polymorphism in the 2B4 gene of inbred mouse strains."
      Kumaresan P.R., Huynh V.T., Mathew P.A.
      Immunogenetics 51:758-761(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: A.CA.
    3. "Characterization of genomic structure and alternative splicing of the murine NK cell receptor 2B4."
      Stepp S.E., Schatzle J.D., Bennett M., Kumar V., Mathew P.A.
      Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Strain: C57BL/6.
    4. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Bone.
    5. "NMR structure of the natural killer cell receptor 2B4 (CD244): implications for ligand recognition."
      Ames J.B., Vyas V., Lusin J.D., Mariuzza R.
      Biochemistry 44:6416-6423(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 21-129, DISULFIDE BOND.
    6. "Structure of natural killer receptor 2B4 bound to CD48 reveals basis for heterophilic recognition in signaling lymphocyte activation molecule family."
      Velikovsky C.A., Deng L., Chlewicki L.K., Fernandez M.M., Kumar V., Mariuzza R.A.
      Immunity 27:572-584(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.63 ANGSTROMS) OF 19-129 ALONE AND IN COMPLEX WITH CD48, DISULFIDE BOND.

    Entry informationi

    Entry nameiCD244_MOUSE
    AccessioniPrimary (citable) accession number: Q07763
    Secondary accession number(s): O88654, Q3UV86, Q9JIE0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 24, 2004
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 107 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3