Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q07763

- CD244_MOUSE

UniProt

Q07763 - CD244_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Natural killer cell receptor 2B4

Gene

Cd244

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Modulates other receptor-ligand interactions to enhance leukocyte activation (By similarity). CD244/2B4 is the only heterophilic receptor of SLAM family.By similarity

GO - Molecular functioni

  1. receptor activity Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

ReactomeiREACT_225233. Cell surface interactions at the vascular wall.

Names & Taxonomyi

Protein namesi
Recommended name:
Natural killer cell receptor 2B4
Alternative name(s):
NK cell type I receptor protein 2B4
Short name:
NKR2B4
Non-MHC restricted killing associated
SLAM family member 4
Short name:
SLAMF4
Signaling lymphocytic activation molecule 4
CD_antigen: CD244
Gene namesi
Name:Cd244
Synonyms:2b4, Nmrk
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 1

Organism-specific databases

MGIiMGI:109294. Cd244.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 226207ExtracellularSequence AnalysisAdd
BLAST
Transmembranei227 – 24721HelicalSequence AnalysisAdd
BLAST
Topological domaini248 – 397150CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. external side of plasma membrane Source: MGI
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence AnalysisAdd
BLAST
Chaini20 – 397378Natural killer cell receptor 2B4PRO_0000014669Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi22 ↔ 1192 Publications
Glycosylationi78 – 781N-linked (GlcNAc...)Sequence Analysis
Glycosylationi145 – 1451N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi154 ↔ 196By similarity
Glycosylationi161 – 1611N-linked (GlcNAc...)Sequence Analysis
Glycosylationi178 – 1781N-linked (GlcNAc...)Sequence Analysis
Glycosylationi197 – 1971N-linked (GlcNAc...)Sequence Analysis
Glycosylationi206 – 2061N-linked (GlcNAc...)Sequence Analysis
Glycosylationi210 – 2101N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

N-linked glycosylation is essential for the binding to its ligand CD48. Also O-glycosylated, in contrast, O-linked sialylation has a negative impact on ligand binding (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiQ07763.

PTM databases

PhosphoSiteiQ07763.

Expressioni

Gene expression databases

BgeeiQ07763.
CleanExiMM_CD244.
GenevestigatoriQ07763.

Interactioni

Subunit structurei

Interacts with CD48. Following phosphorylation, it is able to recruit PTPN11/SHP-2 and SH2D1A/SAP. Binding of SH2D1A/SAP to CD244 prevents its association with PTPN11/SHP-2 (By similarity).By similarity

Protein-protein interaction databases

BioGridi201792. 2 interactions.
STRINGi10090.ENSMUSP00000004829.

Structurei

Secondary structure

1
397
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi25 – 317Combined sources
Beta strandi37 – 393Combined sources
Beta strandi50 – 567Combined sources
Beta strandi60 – 623Combined sources
Beta strandi63 – 7311Combined sources
Beta strandi76 – 783Combined sources
Helixi79 – 835Combined sources
Beta strandi85 – 873Combined sources
Turni89 – 913Combined sources
Beta strandi94 – 985Combined sources
Helixi101 – 1033Combined sources
Beta strandi105 – 1128Combined sources
Beta strandi117 – 12711Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1Z2KNMR-A21-129[»]
2PTTX-ray1.63B19-129[»]
2PTUX-ray2.38A/B/C/D19-129[»]
ProteinModelPortaliQ07763.
SMRiQ07763. Positions 21-128.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ07763.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini22 – 129108Ig-like 1Add
BLAST
Domaini131 – 21585Ig-like 2Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG46473.
GeneTreeiENSGT00510000049238.
HOVERGENiHBG050850.
InParanoidiQ07763.
KOiK06582.
OMAiHTYTCNV.
OrthoDBiEOG7QVM45.
TreeFamiTF334964.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR024304. NK_rcpt_2B4.
IPR024303. NK_rcpt_2B4_Ig_dom.
IPR015631. SLAM_fam_rcpts.
[Graphical view]
PANTHERiPTHR12080. PTHR12080. 1 hit.
PTHR12080:SF3. PTHR12080:SF3. 1 hit.
PfamiPF11465. Receptor_2B4. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q07763-1) [UniParc]FASTAAdd to Basket

Also known as: m2B4L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLGQAVLFTT FLLLRAHQGQ DCPDSSEEVV GVSGKPVQLR PSNIQTKDVS
60 70 80 90 100
VQWKKTEQGS HRKIEILNWY NDGPSWSNVS FSDIYGFDYG DFALSIKSAK
110 120 130 140 150
LQDSGHYLLE ITNTGGKVCN KNFQLLILDH VETPNLKAQW KPWTNGTCQL
160 170 180 190 200
FLSCLVTKDD NVSYALYRGS TLISNQRNST HWENQIDASS LHTYTCNVSN
210 220 230 240 250
RASWANHTLN FTHGCQSVPS NFRFLPFGVI IVILVTLFLG AIICFCVWTK
260 270 280 290 300
KRKQLQFSPK EPLTIYEYVK DSRASRDQQG CSRASGSPSA VQEDGRGQRE
310 320 330 340 350
LDRRVSEVLE QLPQQTFPGD RGTMYSMIQC KPSDSTSQEK CTVYSVVQPS
360 370 380 390
RKSGSKKRNQ NSSLSCTVYE EVGNPWLKAH NPARLSRREL ENFDVYS
Length:397
Mass (Da):44,836
Last modified:July 27, 2011 - v3
Checksum:i0E2F0D946F7B63A7
GO
Isoform 2 (identifier: Q07763-2) [UniParc]FASTAAdd to Basket

Also known as: m2B4S

The sequence of this isoform differs from the canonical sequence as follows:
     309-340: LEQLPQQTFPGDRGTMYSMIQCKPSDSTSQEK → MFSSLLAFLLHQFPGSTQRGKEKRERAEKNGK
     341-397: Missing.

Note: No experimental confirmation available.

Show »
Length:340
Mass (Da):38,397
Checksum:i0D5275A1A354FC1E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti38 – 381Q → P in AAF91290. (PubMed:10941850)Curated
Sequence conflicti156 – 1561V → A in AAF91290. (PubMed:10941850)Curated
Sequence conflicti166 – 1661L → FW in AAA16353. (PubMed:8228228)Curated
Sequence conflicti362 – 3621S → Y in AAA16353. (PubMed:8228228)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei309 – 34032LEQLP…TSQEK → MFSSLLAFLLHQFPGSTQRG KEKRERAEKNGK in isoform 2. 1 PublicationVSP_010401Add
BLAST
Alternative sequencei341 – 39757Missing in isoform 2. 1 PublicationVSP_010402Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19057 mRNA. Translation: AAA16353.1.
AF234831 mRNA. Translation: AAF91290.1.
AF082803 mRNA. Translation: AAC34859.1.
AK137505 mRNA. Translation: BAE23386.1.
CCDSiCCDS35778.1. [Q07763-1]
PIRiI49443.
RefSeqiNP_061199.2. NM_018729.2. [Q07763-1]
UniGeneiMm.2299.

Genome annotation databases

EnsembliENSMUST00000004829; ENSMUSP00000004829; ENSMUSG00000004709. [Q07763-1]
GeneIDi18106.
KEGGimmu:18106.
UCSCiuc007dos.1. mouse. [Q07763-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19057 mRNA. Translation: AAA16353.1 .
AF234831 mRNA. Translation: AAF91290.1 .
AF082803 mRNA. Translation: AAC34859.1 .
AK137505 mRNA. Translation: BAE23386.1 .
CCDSi CCDS35778.1. [Q07763-1 ]
PIRi I49443.
RefSeqi NP_061199.2. NM_018729.2. [Q07763-1 ]
UniGenei Mm.2299.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1Z2K NMR - A 21-129 [» ]
2PTT X-ray 1.63 B 19-129 [» ]
2PTU X-ray 2.38 A/B/C/D 19-129 [» ]
ProteinModelPortali Q07763.
SMRi Q07763. Positions 21-128.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 201792. 2 interactions.
STRINGi 10090.ENSMUSP00000004829.

PTM databases

PhosphoSitei Q07763.

Proteomic databases

PRIDEi Q07763.

Protocols and materials databases

DNASUi 18106.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000004829 ; ENSMUSP00000004829 ; ENSMUSG00000004709 . [Q07763-1 ]
GeneIDi 18106.
KEGGi mmu:18106.
UCSCi uc007dos.1. mouse. [Q07763-1 ]

Organism-specific databases

CTDi 51744.
MGIi MGI:109294. Cd244.

Phylogenomic databases

eggNOGi NOG46473.
GeneTreei ENSGT00510000049238.
HOVERGENi HBG050850.
InParanoidi Q07763.
KOi K06582.
OMAi HTYTCNV.
OrthoDBi EOG7QVM45.
TreeFami TF334964.

Enzyme and pathway databases

Reactomei REACT_225233. Cell surface interactions at the vascular wall.

Miscellaneous databases

EvolutionaryTracei Q07763.
NextBioi 293289.
PROi Q07763.
SOURCEi Search...

Gene expression databases

Bgeei Q07763.
CleanExi MM_CD244.
Genevestigatori Q07763.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
InterProi IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR024304. NK_rcpt_2B4.
IPR024303. NK_rcpt_2B4_Ig_dom.
IPR015631. SLAM_fam_rcpts.
[Graphical view ]
PANTHERi PTHR12080. PTHR12080. 1 hit.
PTHR12080:SF3. PTHR12080:SF3. 1 hit.
Pfami PF11465. Receptor_2B4. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of the 2B4 gene encoding a molecule associated with non-MHC-restricted killing mediated by activated natural killer cells and T cells."
    Mathew P.A., Garni-Wagner B.A., Land K., Takashima A., Stoneman E., Bennett M., Kumar V.
    J. Immunol. 151:5328-5337(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: C57BL/6.
  2. "Polymorphism in the 2B4 gene of inbred mouse strains."
    Kumaresan P.R., Huynh V.T., Mathew P.A.
    Immunogenetics 51:758-761(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: A.CA.
  3. "Characterization of genomic structure and alternative splicing of the murine NK cell receptor 2B4."
    Stepp S.E., Schatzle J.D., Bennett M., Kumar V., Mathew P.A.
    Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: C57BL/6.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Bone.
  5. "NMR structure of the natural killer cell receptor 2B4 (CD244): implications for ligand recognition."
    Ames J.B., Vyas V., Lusin J.D., Mariuzza R.
    Biochemistry 44:6416-6423(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 21-129, DISULFIDE BOND.
  6. "Structure of natural killer receptor 2B4 bound to CD48 reveals basis for heterophilic recognition in signaling lymphocyte activation molecule family."
    Velikovsky C.A., Deng L., Chlewicki L.K., Fernandez M.M., Kumar V., Mariuzza R.A.
    Immunity 27:572-584(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.63 ANGSTROMS) OF 19-129 ALONE AND IN COMPLEX WITH CD48, DISULFIDE BOND.

Entry informationi

Entry nameiCD244_MOUSE
AccessioniPrimary (citable) accession number: Q07763
Secondary accession number(s): O88654, Q3UV86, Q9JIE0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: July 27, 2011
Last modified: November 26, 2014
This is version 109 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3