Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q07763 (CD244_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 105. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Natural killer cell receptor 2B4
Alternative name(s):
NK cell type I receptor protein 2B4
Short name=NKR2B4
Non-MHC restricted killing associated
SLAM family member 4
Short name=SLAMF4
Signaling lymphocytic activation molecule 4
CD_antigen=CD244
Gene names
Name:Cd244
Synonyms:2b4, Nmrk
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length397 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Modulates other receptor-ligand interactions to enhance leukocyte activation By similarity. CD244/2B4 is the only heterophilic receptor of SLAM family.

Subunit structure

Interacts with CD48. Following phosphorylation, it is able to recruit PTPN11/SHP-2 and SH2D1A/SAP. Binding of SH2D1A/SAP to CD244 prevents its association with PTPN11/SHP-2 By similarity.

Subcellular location

Membrane; Single-pass type I membrane protein Potential.

Post-translational modification

N-linked glycosylation is essential for the binding to its ligand CD48. Also O-glycosylated, in contrast, O-linked sialylation has a negative impact on ligand binding By similarity.

Sequence similarities

Contains 2 Ig-like (immunoglobulin-like) domains.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q07763-1)

Also known as: m2B4L;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q07763-2)

Also known as: m2B4S;

The sequence of this isoform differs from the canonical sequence as follows:
     309-340: LEQLPQQTFPGDRGTMYSMIQCKPSDSTSQEK → MFSSLLAFLLHQFPGSTQRGKEKRERAEKNGK
     341-397: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1919 Potential
Chain20 – 397378Natural killer cell receptor 2B4
PRO_0000014669

Regions

Topological domain20 – 226207Extracellular Potential
Transmembrane227 – 24721Helical; Potential
Topological domain248 – 397150Cytoplasmic Potential
Domain22 – 129108Ig-like 1
Domain131 – 21585Ig-like 2

Amino acid modifications

Glycosylation781N-linked (GlcNAc...) Potential
Glycosylation1451N-linked (GlcNAc...) Potential
Glycosylation1611N-linked (GlcNAc...) Potential
Glycosylation1781N-linked (GlcNAc...) Potential
Glycosylation1971N-linked (GlcNAc...) Potential
Glycosylation2061N-linked (GlcNAc...) Potential
Glycosylation2101N-linked (GlcNAc...) Potential
Disulfide bond22 ↔ 119 Ref.5 Ref.6
Disulfide bond154 ↔ 196 By similarity

Natural variations

Alternative sequence309 – 34032LEQLP…TSQEK → MFSSLLAFLLHQFPGSTQRG KEKRERAEKNGK in isoform 2.
VSP_010401
Alternative sequence341 – 39757Missing in isoform 2.
VSP_010402

Experimental info

Sequence conflict381Q → P in AAF91290. Ref.2
Sequence conflict1561V → A in AAF91290. Ref.2
Sequence conflict1661L → FW in AAA16353. Ref.1
Sequence conflict3621S → Y in AAA16353. Ref.1

Secondary structure

......................... 397
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (m2B4L) [UniParc].

Last modified July 27, 2011. Version 3.
Checksum: 0E2F0D946F7B63A7

FASTA39744,836
        10         20         30         40         50         60 
MLGQAVLFTT FLLLRAHQGQ DCPDSSEEVV GVSGKPVQLR PSNIQTKDVS VQWKKTEQGS 

        70         80         90        100        110        120 
HRKIEILNWY NDGPSWSNVS FSDIYGFDYG DFALSIKSAK LQDSGHYLLE ITNTGGKVCN 

       130        140        150        160        170        180 
KNFQLLILDH VETPNLKAQW KPWTNGTCQL FLSCLVTKDD NVSYALYRGS TLISNQRNST 

       190        200        210        220        230        240 
HWENQIDASS LHTYTCNVSN RASWANHTLN FTHGCQSVPS NFRFLPFGVI IVILVTLFLG 

       250        260        270        280        290        300 
AIICFCVWTK KRKQLQFSPK EPLTIYEYVK DSRASRDQQG CSRASGSPSA VQEDGRGQRE 

       310        320        330        340        350        360 
LDRRVSEVLE QLPQQTFPGD RGTMYSMIQC KPSDSTSQEK CTVYSVVQPS RKSGSKKRNQ 

       370        380        390 
NSSLSCTVYE EVGNPWLKAH NPARLSRREL ENFDVYS 

« Hide

Isoform 2 (m2B4S) [UniParc].

Checksum: 0D5275A1A354FC1E
Show »

FASTA34038,397

References

« Hide 'large scale' references
[1]"Cloning and characterization of the 2B4 gene encoding a molecule associated with non-MHC-restricted killing mediated by activated natural killer cells and T cells."
Mathew P.A., Garni-Wagner B.A., Land K., Takashima A., Stoneman E., Bennett M., Kumar V.
J. Immunol. 151:5328-5337(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: C57BL/6.
[2]"Polymorphism in the 2B4 gene of inbred mouse strains."
Kumaresan P.R., Huynh V.T., Mathew P.A.
Immunogenetics 51:758-761(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: A.CA.
[3]"Characterization of genomic structure and alternative splicing of the murine NK cell receptor 2B4."
Stepp S.E., Schatzle J.D., Bennett M., Kumar V., Mathew P.A.
Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Strain: C57BL/6.
[4]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6J.
Tissue: Bone.
[5]"NMR structure of the natural killer cell receptor 2B4 (CD244): implications for ligand recognition."
Ames J.B., Vyas V., Lusin J.D., Mariuzza R.
Biochemistry 44:6416-6423(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 21-129, DISULFIDE BOND.
[6]"Structure of natural killer receptor 2B4 bound to CD48 reveals basis for heterophilic recognition in signaling lymphocyte activation molecule family."
Velikovsky C.A., Deng L., Chlewicki L.K., Fernandez M.M., Kumar V., Mariuzza R.A.
Immunity 27:572-584(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.63 ANGSTROMS) OF 19-129 ALONE AND IN COMPLEX WITH CD48, DISULFIDE BOND.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L19057 mRNA. Translation: AAA16353.1.
AF234831 mRNA. Translation: AAF91290.1.
AF082803 mRNA. Translation: AAC34859.1.
AK137505 mRNA. Translation: BAE23386.1.
CCDSCCDS35778.1. [Q07763-1]
PIRI49443.
RefSeqNP_061199.2. NM_018729.2. [Q07763-1]
UniGeneMm.2299.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1Z2KNMR-A21-129[»]
2PTTX-ray1.63B19-129[»]
2PTUX-ray2.38A/B/C/D19-129[»]
ProteinModelPortalQ07763.
SMRQ07763. Positions 21-128.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid201792. 2 interactions.
STRING10090.ENSMUSP00000004829.

PTM databases

PhosphoSiteQ07763.

Proteomic databases

PRIDEQ07763.

Protocols and materials databases

DNASU18106.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000004829; ENSMUSP00000004829; ENSMUSG00000004709. [Q07763-1]
GeneID18106.
KEGGmmu:18106.
UCSCuc007dos.1. mouse. [Q07763-1]

Organism-specific databases

CTD51744.
MGIMGI:109294. Cd244.

Phylogenomic databases

eggNOGNOG46473.
GeneTreeENSGT00510000049238.
HOVERGENHBG050850.
InParanoidQ3UV86.
KOK06582.
OMAHTYTCNV.
OrthoDBEOG7QVM45.
TreeFamTF334964.

Gene expression databases

BgeeQ07763.
CleanExMM_CD244.
GenevestigatorQ07763.

Family and domain databases

Gene3D2.60.40.10. 1 hit.
InterProIPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR024304. NK_rcpt_2B4.
IPR024303. NK_rcpt_2B4_Ig_dom.
IPR015631. SLAM_fam_rcpts.
[Graphical view]
PANTHERPTHR12080. PTHR12080. 1 hit.
PTHR12080:SF3. PTHR12080:SF3. 1 hit.
PfamPF11465. Receptor_2B4. 1 hit.
[Graphical view]
SMARTSM00409. IG. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ07763.
NextBio293289.
PROQ07763.
SOURCESearch...

Entry information

Entry nameCD244_MOUSE
AccessionPrimary (citable) accession number: Q07763
Secondary accession number(s): O88654, Q3UV86, Q9JIE0
Entry history
Integrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: July 27, 2011
Last modified: July 9, 2014
This is version 105 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot