Q07563 (COHA1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Collagen alpha-1(XVII) chain Alternative name(s): 180 kDa bullous pemphigoid antigen 2 Bullous pemphigoid antigen 2 Cleaved into the following chain: | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1470 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in the integrity of hemidesmosome and the attachment of basal keratinocytes to the underlying basement membrane By similarity. The 120 kDa linear IgA disease antigen homolog is an anchoring filament component involved in dermal-epidermal cohesion By similarity. |
| Subunit structure | Homotrimers of alpha 1(XVII)chains. Interacts (via cytoplasmic region) with ITGB4 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST (via N-terminus). Interacts (via N-terminus) with PLEC. Interacts (via cytoplasmic region) with DSP By similarity. |
| Subcellular location | Cell junction › hemidesmosome. Membrane; Single-pass type II membrane protein. Note: Localized along the plasma membrane of the hemidesmosome By similarity. 120 kDa linear IgA disease antigen homolog: Secreted › extracellular space › extracellular matrix › basement membrane By similarity. |
| Post-translational modification | The intracellular/endo domain is disulfide-linked By similarity. Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains. The ectodomain is shedded from the surface of keratinocytes resulting in a 120-kDa soluble form, also named as 120 kDa linear IgA disease antigen homolog. The shedding is mediated by membrane-bound metalloproteases. This cleavage is inhibited by phosophorylation at Ser-551 By similarity. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Basement membrane Cell junction Extracellular matrix Membrane Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Collagen Repeat Signal-anchor Transmembrane Transmembrane helix |
| PTM | Disulfide bond Glycoprotein Hydroxylation Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | hemidesmosome assembly Inferred from sequence or structural similarity. Source: UniProtKB |
| Cellular_component | basement membrane Inferred from electronic annotation. Source: UniProtKB-SubCell collagenInferred from electronic annotation. Source: UniProtKB-KW hemidesmosomeInferred from direct assay PubMed 8707838. Source: MGI integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ELANE | P08246 | 2 | EBI-6251005,EBI-986345 | From a different organism. |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q07563-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q07563-2) The sequence of this isoform differs from the canonical sequence as follows: 1157-1194: GSDYRNIIGPPGPPGPPGMPGNAWSSISVEDLSSYLHT → A |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1470 | 1470 | Collagen alpha-1(XVII) chain | PRO_0000059408 | |||||
| Chain | 531 – 1470 | 940 | 120 kDa linear IgA disease antigen homolog By similarity | PRO_0000342558 | |||||
Regions | |||||||||
| Topological domain | 1 – 476 | 476 | Cytoplasmic Potential | ||||||
| Transmembrane | 477 – 497 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 498 – 1470 | 973 | Extracellular Potential | ||||||
| Region | 1 – 573 | 573 | Nonhelical region (NC16) | ||||||
| Region | 146 – 231 | 86 | Necessary for interaction with DST and for the recruitment of DST to hemidesmosome By similarity | ||||||
| Region | 574 – 1456 | 883 | Triple-helical region | ||||||
| Region | 1457 – 1470 | 14 | Nonhelical region (NC1) | ||||||
Amino acid modifications | |||||||||
| Modified residue | 85 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 93 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 149 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 551 | 1 | Phosphoserine; by CK2 By similarity | ||||||
| Glycosylation | 1273 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1395 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1157 – 1194 | 38 | GSDYR…SYLHT → A in isoform 2. | VSP_009362 | |||||
Experimental info | |||||||||
| Sequence conflict | 164 | 1 | R → S in AAA37443. Ref.1 | ||||||
| Sequence conflict | 289 | 1 | A → G in AAA37443. Ref.1 | ||||||
| Sequence conflict | 324 | 1 | S → C in AAA37443. Ref.1 | ||||||
| Sequence conflict | 1275 | 1 | S → G in AAH03208. Ref.3 | ||||||
| Sequence conflict | 1277 | 1 | N → S in AAA37443. Ref.1 | ||||||
| Sequence conflict | 1277 | 1 | N → S in AAH03208. Ref.3 | ||||||
| Sequence conflict | 1277 | 1 | N → S in AAI25032. Ref.3 | ||||||
| Sequence conflict | 1277 | 1 | N → S in AAI25033. Ref.3 | ||||||
| Sequence conflict | 1292 | 1 | T → I in AAA37443. Ref.1 | ||||||
| Sequence conflict | 1292 | 1 | T → I in AAH03208. Ref.3 | ||||||
| Sequence conflict | 1292 | 1 | T → I in AAI25032. Ref.3 | ||||||
| Sequence conflict | 1292 | 1 | T → I in AAI25033. Ref.3 | ||||||
| Sequence conflict | 1388 | 1 | R → W in AAA37443. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of type XVII collagen: complementary and genomic DNA sequences of mouse 180-kDa bullous pemphigoid antigen (BPAG2) predict an interrupted collagenous domain, a transmembrane segment, and unusual features in the 5'-end of the gene and the 3' -." Li K., Tamai K., Tan E.M.L., Uitto J. J. Biol. Chem. 268:8825-8834(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: BALB/c. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Mammary gland. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1357-1470. Strain: C57BL/6J. Tissue: Cerebellum. |
| [5] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-85; SER-93 AND SER-149, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L08407 mRNA. Translation: AAA37443.1. AC131719 Genomic DNA. No translation available. BC003208 mRNA. Translation: AAH03208.1. BC125031 mRNA. Translation: AAI25032.1. BC125032 mRNA. Translation: AAI25033.1. AK135150 mRNA. Translation: BAE22442.1. |
| IPI | IPI00284644. IPI00399843. |
| PIR | A46053. |
| RefSeq | NP_031758.2. NM_007732.2. |
| UniGene | Mm.1225. |
3D structure databases | |
| ProteinModelPortal | Q07563. |
| SMR | Q07563. Positions 1404-1440. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q07563. 1 interaction. |
PTM databases | |
| PhosphoSite | Q07563. |
Proteomic databases | |
| PaxDb | Q07563. |
| PRIDE | Q07563. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000026045; ENSMUSP00000026045; ENSMUSG00000025064. ENSMUST00000086923; ENSMUSP00000084141; ENSMUSG00000025064. |
| GeneID | 12821. |
| KEGG | mmu:12821. |
| UCSC | uc008hvi.2. mouse. uc008hvj.2. mouse. |
Organism-specific databases | |
| CTD | 1308. |
| MGI | MGI:88450. Col17a1. |
Phylogenomic databases | |
| eggNOG | NOG309396. |
| GeneTree | ENSGT00700000104250. |
| HOGENOM | HOG000111885. |
| HOVERGEN | HBG051065. |
| InParanoid | Q07563. |
| KO | K07603. |
| OMA | LDYAELS. |
| OrthoDB | EOG4RNB7V. |
Gene expression databases | |
| Bgee | Q07563. |
| CleanEx | MM_COL17A1. |
| Genevestigator | Q07563. |
| GermOnline | ENSMUSG00000025064. Mus musculus. |
Family and domain databases | |
| InterPro | IPR008160. Collagen. [Graphical view] |
| Pfam | PF01391. Collagen. 4 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 282294. |
| SOURCE | Search... |
Entry information
| Entry name | COHA1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q07563 Secondary accession number(s): Q08AT3, Q3UXX1, Q99LK8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |

Clusters with
