Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q07563

- COHA1_MOUSE

UniProt

Q07563 - COHA1_MOUSE

Protein

Collagen alpha-1(XVII) chain

Gene

Col17a1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 123 (01 Oct 2014)
      Sequence version 3 (01 May 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in the integrity of hemidesmosome and the attachment of basal keratinocytes to the underlying basement membrane.By similarity
    The 120 kDa linear IgA disease antigen homolog is an anchoring filament component involved in dermal-epidermal cohesion.By similarity

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. hemidesmosome assembly Source: UniProtKB

    Enzyme and pathway databases

    ReactomeiREACT_198984. Collagen biosynthesis and modifying enzymes.
    REACT_199055. Collagen degradation.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Collagen alpha-1(XVII) chain
    Alternative name(s):
    180 kDa bullous pemphigoid antigen 2
    Bullous pemphigoid antigen 2
    Cleaved into the following chain:
    Gene namesi
    Name:Col17a1
    Synonyms:Bp180, Bpag2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 19

    Organism-specific databases

    MGIiMGI:88450. Col17a1.

    Subcellular locationi

    Cell junctionhemidesmosome. Membrane; Single-pass type II membrane protein
    Note: Localized along the plasma membrane of the hemidesmosome.By similarity

    GO - Cellular componenti

    1. basement membrane Source: UniProtKB-SubCell
    2. collagen trimer Source: UniProtKB-KW
    3. hemidesmosome Source: MGI
    4. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Basement membrane, Cell junction, Extracellular matrix, Membrane, Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 14701470Collagen alpha-1(XVII) chainPRO_0000059408Add
    BLAST
    Chaini531 – 1470940120 kDa linear IgA disease antigen homologBy similarityPRO_0000342558Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei551 – 5511Phosphoserine; by CK2By similarity
    Glycosylationi1273 – 12731N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1395 – 13951N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    The intracellular/endo domain is disulfide-linked.By similarity
    Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.
    The ectodomain is shedded from the surface of keratinocytes resulting in a 120-kDa soluble form, also named as 120 kDa linear IgA disease antigen homolog. The shedding is mediated by membrane-bound metalloproteases. This cleavage is inhibited by phosophorylation at Ser-551 By similarity.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Hydroxylation, Phosphoprotein

    Proteomic databases

    PaxDbiQ07563.
    PRIDEiQ07563.

    PTM databases

    PhosphoSiteiQ07563.

    Expressioni

    Gene expression databases

    BgeeiQ07563.
    CleanExiMM_COL17A1.
    GenevestigatoriQ07563.

    Interactioni

    Subunit structurei

    Homotrimers of alpha 1(XVII)chains. Interacts (via cytoplasmic region) with ITGB4 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST (via N-terminus). Interacts (via N-terminus) with PLEC. Interacts (via cytoplasmic region) with DSP By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ELANEP082462EBI-6251005,EBI-986345From a different organism.

    Protein-protein interaction databases

    IntActiQ07563. 1 interaction.

    Structurei

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 476476CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini498 – 1470973ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei477 – 49721Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 573573Nonhelical region (NC16)Add
    BLAST
    Regioni146 – 23186Necessary for interaction with DST and for the recruitment of DST to hemidesmosomeBy similarityAdd
    BLAST
    Regioni574 – 1456883Triple-helical regionAdd
    BLAST
    Regioni1457 – 147014Nonhelical region (NC1)Add
    BLAST

    Keywords - Domaini

    Collagen, Repeat, Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG309396.
    GeneTreeiENSGT00740000115363.
    HOGENOMiHOG000111885.
    HOVERGENiHBG051065.
    InParanoidiQ07563.
    KOiK07603.
    OMAiLLHKDCK.
    OrthoDBiEOG76QFJV.
    PhylomeDBiQ07563.
    TreeFamiTF332289.

    Family and domain databases

    InterProiIPR008160. Collagen.
    [Graphical view]
    PfamiPF01391. Collagen. 4 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q07563-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDVTKKSKRD GTEVTERIVT ETVTTRLTSL PPKGSTSNGY AKTGSLGGGS     50
    RLEKQSLTHG SSGYINSSGS IRGNASTSSY RRTHSPASTL PNSPGSTFER 100
    KAHMTRHGTY EGSSSGNSSP EYPRKELASS STRGRSQTRE SEIRVRLQSA 150
    SPSTRWTELD EVKRLLKGSR SASASPTRNT SNTLPIPKKG TVETKTVTAS 200
    SHSVSGTYDS AILDTNFPPH MWSSTLPAGS SLGTYQNNIT AQSTSLLNTN 250
    AYSTGSVFGV PNNMASCSPT LHPGLSSCSS VFGMQNNLAP SSSVLSHGTT 300
    TASTAYGAKK NVPQPPTVTS TGVSTSATCT TSVQSDDLLH KDCKFLILEK 350
    DNTPAKKEME LLIMTKDSGK VFTASPATIS STSFSEDTLK KEKQAAYAAD 400
    TCLKADVNGD LNTVSTKSKM TSAENHGYDR GGGGGRGKGG GAGGGGGGGG 450
    ASGGGGAWGA APAWCPCGSC CSWWKWLLGL LLTWLLLLGL LFGLIALAEE 500
    VRKLKARVEE LEKTKVLYHD VQMDKSNRDR LQAEAPSLGP GLGKAELDGY 550
    SQEAIWLFVR NKLMTEQENG NLRGSPGPKG DMGSQGPKGD RGLPGTPGIP 600
    GPLGHPGPEG PKGQKGSIGD PGMEGPIGQR GLAGPMGPRG EPGPPGSGEK 650
    GDRGIAGEQG PQGLPGVPGP PGLRGHSGSP GPQGPPGAVG PQGLRGDVGL 700
    PGVKGDKGLM GPPGPKGDQG EKGPRGLTGE PGIRGLPGAV GEPGAKGAMG 750
    PAGADGQQGS RGEQGLTGMP GTRGPPGPAG DPGKPGLTGP QGPQGLPGSP 800
    GRPGTKGEPG APGRVMTSEG SSTITVPGPP GPPGAMGPPG PPGTPGPAGP 850
    AGLPGQQGPR GEPGLAGDSF LSSGSSISEV LSAQGVDLRG PPGPPGPRGP 900
    PGPSIPGPPG PRGPPGEGVP GPPGPPGSFL TDSETFFTGP PGPPGPPGPK 950
    GDQGDPGVPG TPGISGGLSH GASSSTLYMQ GPPGPPGPPG PPGSLSSSGQ 1000
    DIQHYIAEYM QSDNIRTYLS GVQGPPGPPG PPGPVITITG ETFDYSQLAS 1050
    QVVSYLRSSG YGAGLSSASS SEDILAMLRR NDVWQYLRQN LVGPPGPPGP 1100
    PGVSGDGSLL SLDYGELSRH ILNYMSSSGI SFGHPGPPGP PGLPGTSYEE 1150
    LLTMLRGSDY RNIIGPPGPP GPPGMPGNAW SSISVEDLSS YLHTAGLSSI 1200
    PGPPGPPGPP GPRGPPGVSA ALSTYAAENS DNFRSELISY LTSPDVRSFI 1250
    VGPPGPPGPQ GPPGDGHLRE NYNWSSNSSA RRGTSYSSST GTGGTNGGSL 1300
    GEGGAYGAGD GGPYGTDIGP GGGYGAAAGG GIYGTNGDSF RDGFTGDLDY 1350
    NKLAVRVSES MQRQGLLQGM AYTVQGPPGP QGPPGISRVF SAYSNVTQDL 1400
    MDFFQTYGTI PGPPGQKGDV GTPGPKGDRG PAGPRGPPGP PGPRGNKGEK 1450
    GDKGDQVYTG RRKRSIAIKP 1470
    Length:1,470
    Mass (Da):147,975
    Last modified:May 1, 2007 - v3
    Checksum:i7C38356D6ED68347
    GO
    Isoform 2 (identifier: Q07563-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1157-1194: GSDYRNIIGPPGPPGPPGMPGNAWSSISVEDLSSYLHT → A

    Show »
    Length:1,433
    Mass (Da):144,140
    Checksum:i0C8997CF58634BA1
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti164 – 1641R → S in AAA37443. (PubMed:8473327)Curated
    Sequence conflicti289 – 2891A → G in AAA37443. (PubMed:8473327)Curated
    Sequence conflicti324 – 3241S → C in AAA37443. (PubMed:8473327)Curated
    Sequence conflicti1275 – 12751S → G in AAH03208. (PubMed:15489334)Curated
    Sequence conflicti1277 – 12771N → S in AAA37443. (PubMed:8473327)Curated
    Sequence conflicti1277 – 12771N → S in AAH03208. (PubMed:15489334)Curated
    Sequence conflicti1277 – 12771N → S in AAI25032. (PubMed:15489334)Curated
    Sequence conflicti1277 – 12771N → S in AAI25033. (PubMed:15489334)Curated
    Sequence conflicti1292 – 12921T → I in AAA37443. (PubMed:8473327)Curated
    Sequence conflicti1292 – 12921T → I in AAH03208. (PubMed:15489334)Curated
    Sequence conflicti1292 – 12921T → I in AAI25032. (PubMed:15489334)Curated
    Sequence conflicti1292 – 12921T → I in AAI25033. (PubMed:15489334)Curated
    Sequence conflicti1388 – 13881R → W in AAA37443. (PubMed:8473327)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1157 – 119438GSDYR…SYLHT → A in isoform 2. 1 PublicationVSP_009362Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L08407 mRNA. Translation: AAA37443.1.
    AC131719 Genomic DNA. No translation available.
    BC003208 mRNA. Translation: AAH03208.1.
    BC125031 mRNA. Translation: AAI25032.1.
    BC125032 mRNA. Translation: AAI25033.1.
    AK135150 mRNA. Translation: BAE22442.1.
    CCDSiCCDS38018.1. [Q07563-2]
    CCDS70959.1. [Q07563-1]
    PIRiA46053.
    RefSeqiNP_001277754.1. NM_001290825.1. [Q07563-1]
    NP_031758.2. NM_007732.2. [Q07563-2]
    UniGeneiMm.1225.

    Genome annotation databases

    EnsembliENSMUST00000026045; ENSMUSP00000026045; ENSMUSG00000025064. [Q07563-1]
    ENSMUST00000086923; ENSMUSP00000084141; ENSMUSG00000025064. [Q07563-2]
    GeneIDi12821.
    KEGGimmu:12821.
    UCSCiuc008hvi.2. mouse. [Q07563-2]
    uc008hvj.2. mouse. [Q07563-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L08407 mRNA. Translation: AAA37443.1 .
    AC131719 Genomic DNA. No translation available.
    BC003208 mRNA. Translation: AAH03208.1 .
    BC125031 mRNA. Translation: AAI25032.1 .
    BC125032 mRNA. Translation: AAI25033.1 .
    AK135150 mRNA. Translation: BAE22442.1 .
    CCDSi CCDS38018.1. [Q07563-2 ]
    CCDS70959.1. [Q07563-1 ]
    PIRi A46053.
    RefSeqi NP_001277754.1. NM_001290825.1. [Q07563-1 ]
    NP_031758.2. NM_007732.2. [Q07563-2 ]
    UniGenei Mm.1225.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q07563. 1 interaction.

    PTM databases

    PhosphoSitei Q07563.

    Proteomic databases

    PaxDbi Q07563.
    PRIDEi Q07563.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000026045 ; ENSMUSP00000026045 ; ENSMUSG00000025064 . [Q07563-1 ]
    ENSMUST00000086923 ; ENSMUSP00000084141 ; ENSMUSG00000025064 . [Q07563-2 ]
    GeneIDi 12821.
    KEGGi mmu:12821.
    UCSCi uc008hvi.2. mouse. [Q07563-2 ]
    uc008hvj.2. mouse. [Q07563-1 ]

    Organism-specific databases

    CTDi 1308.
    MGIi MGI:88450. Col17a1.

    Phylogenomic databases

    eggNOGi NOG309396.
    GeneTreei ENSGT00740000115363.
    HOGENOMi HOG000111885.
    HOVERGENi HBG051065.
    InParanoidi Q07563.
    KOi K07603.
    OMAi LLHKDCK.
    OrthoDBi EOG76QFJV.
    PhylomeDBi Q07563.
    TreeFami TF332289.

    Enzyme and pathway databases

    Reactomei REACT_198984. Collagen biosynthesis and modifying enzymes.
    REACT_199055. Collagen degradation.

    Miscellaneous databases

    NextBioi 282294.
    PROi Q07563.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q07563.
    CleanExi MM_COL17A1.
    Genevestigatori Q07563.

    Family and domain databases

    InterProi IPR008160. Collagen.
    [Graphical view ]
    Pfami PF01391. Collagen. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning of type XVII collagen: complementary and genomic DNA sequences of mouse 180-kDa bullous pemphigoid antigen (BPAG2) predict an interrupted collagenous domain, a transmembrane segment, and unusual features in the 5'-end of the gene and the 3' -."
      Li K., Tamai K., Tan E.M.L., Uitto J.
      J. Biol. Chem. 268:8825-8834(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Strain: BALB/c.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Mammary gland.
    4. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1357-1470.
      Strain: C57BL/6J.
      Tissue: Cerebellum.

    Entry informationi

    Entry nameiCOHA1_MOUSE
    AccessioniPrimary (citable) accession number: Q07563
    Secondary accession number(s): Q08AT3, Q3UXX1, Q99LK8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 2, 2004
    Last sequence update: May 1, 2007
    Last modified: October 1, 2014
    This is version 123 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3