SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q07563

- COHA1_MOUSE

UniProt

Q07563 - COHA1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Collagen alpha-1(XVII) chain
Gene
Col17a1, Bp180, Bpag2
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May play a role in the integrity of hemidesmosome and the attachment of basal keratinocytes to the underlying basement membrane By similarity.
The 120 kDa linear IgA disease antigen homolog is an anchoring filament component involved in dermal-epidermal cohesion By similarity.

GO - Molecular functioni

  1. protein binding Source: IntAct
Complete GO annotation...

GO - Biological processi

  1. hemidesmosome assembly Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_198984. Collagen biosynthesis and modifying enzymes.
REACT_199055. Collagen degradation.

Names & Taxonomyi

Protein namesi
Recommended name:
Collagen alpha-1(XVII) chain
Alternative name(s):
180 kDa bullous pemphigoid antigen 2
Bullous pemphigoid antigen 2
Cleaved into the following chain:
Gene namesi
Name:Col17a1
Synonyms:Bp180, Bpag2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 19

Organism-specific databases

MGIiMGI:88450. Col17a1.

Subcellular locationi

Cell junctionhemidesmosome. Membrane; Single-pass type II membrane protein
Note: Localized along the plasma membrane of the hemidesmosome By similarity.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 476476Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei477 – 49721Helical; Signal-anchor for type II membrane protein; Reviewed prediction
Add
BLAST
Topological domaini498 – 1470973Extracellular Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. basement membrane Source: UniProtKB-SubCell
  2. collagen trimer Source: UniProtKB-KW
  3. hemidesmosome Source: MGI
  4. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Basement membrane, Cell junction, Extracellular matrix, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14701470Collagen alpha-1(XVII) chain
PRO_0000059408Add
BLAST
Chaini531 – 1470940120 kDa linear IgA disease antigen homolog By similarity
PRO_0000342558Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei551 – 5511Phosphoserine; by CK2 By similarity
Glycosylationi1273 – 12731N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1395 – 13951N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

The intracellular/endo domain is disulfide-linked By similarity.
Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.
The ectodomain is shedded from the surface of keratinocytes resulting in a 120-kDa soluble form, also named as 120 kDa linear IgA disease antigen homolog. The shedding is mediated by membrane-bound metalloproteases. This cleavage is inhibited by phosophorylation at Ser-551 By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein, Hydroxylation, Phosphoprotein

Proteomic databases

PaxDbiQ07563.
PRIDEiQ07563.

PTM databases

PhosphoSiteiQ07563.

Expressioni

Gene expression databases

BgeeiQ07563.
CleanExiMM_COL17A1.
GenevestigatoriQ07563.

Interactioni

Subunit structurei

Homotrimers of alpha 1(XVII)chains. Interacts (via cytoplasmic region) with ITGB4 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST (via N-terminus). Interacts (via N-terminus) with PLEC. Interacts (via cytoplasmic region) with DSP By similarity.

Binary interactionsi

WithEntry#Exp.IntActNotes
ELANEP082462EBI-6251005,EBI-986345From a different organism.

Protein-protein interaction databases

IntActiQ07563. 1 interaction.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 573573Nonhelical region (NC16)
Add
BLAST
Regioni146 – 23186Necessary for interaction with DST and for the recruitment of DST to hemidesmosome By similarity
Add
BLAST
Regioni574 – 1456883Triple-helical region
Add
BLAST
Regioni1457 – 147014Nonhelical region (NC1)
Add
BLAST

Keywords - Domaini

Collagen, Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG309396.
GeneTreeiENSGT00740000115363.
HOGENOMiHOG000111885.
HOVERGENiHBG051065.
InParanoidiQ07563.
KOiK07603.
OMAiLLHKDCK.
OrthoDBiEOG76QFJV.
PhylomeDBiQ07563.
TreeFamiTF332289.

Family and domain databases

InterProiIPR008160. Collagen.
[Graphical view]
PfamiPF01391. Collagen. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q07563-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDVTKKSKRD GTEVTERIVT ETVTTRLTSL PPKGSTSNGY AKTGSLGGGS     50
RLEKQSLTHG SSGYINSSGS IRGNASTSSY RRTHSPASTL PNSPGSTFER 100
KAHMTRHGTY EGSSSGNSSP EYPRKELASS STRGRSQTRE SEIRVRLQSA 150
SPSTRWTELD EVKRLLKGSR SASASPTRNT SNTLPIPKKG TVETKTVTAS 200
SHSVSGTYDS AILDTNFPPH MWSSTLPAGS SLGTYQNNIT AQSTSLLNTN 250
AYSTGSVFGV PNNMASCSPT LHPGLSSCSS VFGMQNNLAP SSSVLSHGTT 300
TASTAYGAKK NVPQPPTVTS TGVSTSATCT TSVQSDDLLH KDCKFLILEK 350
DNTPAKKEME LLIMTKDSGK VFTASPATIS STSFSEDTLK KEKQAAYAAD 400
TCLKADVNGD LNTVSTKSKM TSAENHGYDR GGGGGRGKGG GAGGGGGGGG 450
ASGGGGAWGA APAWCPCGSC CSWWKWLLGL LLTWLLLLGL LFGLIALAEE 500
VRKLKARVEE LEKTKVLYHD VQMDKSNRDR LQAEAPSLGP GLGKAELDGY 550
SQEAIWLFVR NKLMTEQENG NLRGSPGPKG DMGSQGPKGD RGLPGTPGIP 600
GPLGHPGPEG PKGQKGSIGD PGMEGPIGQR GLAGPMGPRG EPGPPGSGEK 650
GDRGIAGEQG PQGLPGVPGP PGLRGHSGSP GPQGPPGAVG PQGLRGDVGL 700
PGVKGDKGLM GPPGPKGDQG EKGPRGLTGE PGIRGLPGAV GEPGAKGAMG 750
PAGADGQQGS RGEQGLTGMP GTRGPPGPAG DPGKPGLTGP QGPQGLPGSP 800
GRPGTKGEPG APGRVMTSEG SSTITVPGPP GPPGAMGPPG PPGTPGPAGP 850
AGLPGQQGPR GEPGLAGDSF LSSGSSISEV LSAQGVDLRG PPGPPGPRGP 900
PGPSIPGPPG PRGPPGEGVP GPPGPPGSFL TDSETFFTGP PGPPGPPGPK 950
GDQGDPGVPG TPGISGGLSH GASSSTLYMQ GPPGPPGPPG PPGSLSSSGQ 1000
DIQHYIAEYM QSDNIRTYLS GVQGPPGPPG PPGPVITITG ETFDYSQLAS 1050
QVVSYLRSSG YGAGLSSASS SEDILAMLRR NDVWQYLRQN LVGPPGPPGP 1100
PGVSGDGSLL SLDYGELSRH ILNYMSSSGI SFGHPGPPGP PGLPGTSYEE 1150
LLTMLRGSDY RNIIGPPGPP GPPGMPGNAW SSISVEDLSS YLHTAGLSSI 1200
PGPPGPPGPP GPRGPPGVSA ALSTYAAENS DNFRSELISY LTSPDVRSFI 1250
VGPPGPPGPQ GPPGDGHLRE NYNWSSNSSA RRGTSYSSST GTGGTNGGSL 1300
GEGGAYGAGD GGPYGTDIGP GGGYGAAAGG GIYGTNGDSF RDGFTGDLDY 1350
NKLAVRVSES MQRQGLLQGM AYTVQGPPGP QGPPGISRVF SAYSNVTQDL 1400
MDFFQTYGTI PGPPGQKGDV GTPGPKGDRG PAGPRGPPGP PGPRGNKGEK 1450
GDKGDQVYTG RRKRSIAIKP 1470
Length:1,470
Mass (Da):147,975
Last modified:May 1, 2007 - v3
Checksum:i7C38356D6ED68347
GO
Isoform 2 (identifier: Q07563-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1157-1194: GSDYRNIIGPPGPPGPPGMPGNAWSSISVEDLSSYLHT → A

Show »
Length:1,433
Mass (Da):144,140
Checksum:i0C8997CF58634BA1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1157 – 119438GSDYR…SYLHT → A in isoform 2.
VSP_009362Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti164 – 1641R → S in AAA37443. 1 Publication
Sequence conflicti289 – 2891A → G in AAA37443. 1 Publication
Sequence conflicti324 – 3241S → C in AAA37443. 1 Publication
Sequence conflicti1275 – 12751S → G in AAH03208. 1 Publication
Sequence conflicti1277 – 12771N → S in AAA37443. 1 Publication
Sequence conflicti1277 – 12771N → S in AAH03208. 1 Publication
Sequence conflicti1277 – 12771N → S in AAI25032. 1 Publication
Sequence conflicti1277 – 12771N → S in AAI25033. 1 Publication
Sequence conflicti1292 – 12921T → I in AAA37443. 1 Publication
Sequence conflicti1292 – 12921T → I in AAH03208. 1 Publication
Sequence conflicti1292 – 12921T → I in AAI25032. 1 Publication
Sequence conflicti1292 – 12921T → I in AAI25033. 1 Publication
Sequence conflicti1388 – 13881R → W in AAA37443. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L08407 mRNA. Translation: AAA37443.1.
AC131719 Genomic DNA. No translation available.
BC003208 mRNA. Translation: AAH03208.1.
BC125031 mRNA. Translation: AAI25032.1.
BC125032 mRNA. Translation: AAI25033.1.
AK135150 mRNA. Translation: BAE22442.1.
CCDSiCCDS38018.1. [Q07563-2]
CCDS70959.1. [Q07563-1]
PIRiA46053.
RefSeqiNP_001277754.1. NM_001290825.1. [Q07563-1]
NP_031758.2. NM_007732.2. [Q07563-2]
UniGeneiMm.1225.

Genome annotation databases

EnsembliENSMUST00000026045; ENSMUSP00000026045; ENSMUSG00000025064. [Q07563-1]
ENSMUST00000086923; ENSMUSP00000084141; ENSMUSG00000025064. [Q07563-2]
GeneIDi12821.
KEGGimmu:12821.
UCSCiuc008hvi.2. mouse. [Q07563-2]
uc008hvj.2. mouse. [Q07563-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L08407 mRNA. Translation: AAA37443.1 .
AC131719 Genomic DNA. No translation available.
BC003208 mRNA. Translation: AAH03208.1 .
BC125031 mRNA. Translation: AAI25032.1 .
BC125032 mRNA. Translation: AAI25033.1 .
AK135150 mRNA. Translation: BAE22442.1 .
CCDSi CCDS38018.1. [Q07563-2 ]
CCDS70959.1. [Q07563-1 ]
PIRi A46053.
RefSeqi NP_001277754.1. NM_001290825.1. [Q07563-1 ]
NP_031758.2. NM_007732.2. [Q07563-2 ]
UniGenei Mm.1225.

3D structure databases

ModBasei Search...

Protein-protein interaction databases

IntActi Q07563. 1 interaction.

PTM databases

PhosphoSitei Q07563.

Proteomic databases

PaxDbi Q07563.
PRIDEi Q07563.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000026045 ; ENSMUSP00000026045 ; ENSMUSG00000025064 . [Q07563-1 ]
ENSMUST00000086923 ; ENSMUSP00000084141 ; ENSMUSG00000025064 . [Q07563-2 ]
GeneIDi 12821.
KEGGi mmu:12821.
UCSCi uc008hvi.2. mouse. [Q07563-2 ]
uc008hvj.2. mouse. [Q07563-1 ]

Organism-specific databases

CTDi 1308.
MGIi MGI:88450. Col17a1.

Phylogenomic databases

eggNOGi NOG309396.
GeneTreei ENSGT00740000115363.
HOGENOMi HOG000111885.
HOVERGENi HBG051065.
InParanoidi Q07563.
KOi K07603.
OMAi LLHKDCK.
OrthoDBi EOG76QFJV.
PhylomeDBi Q07563.
TreeFami TF332289.

Enzyme and pathway databases

Reactomei REACT_198984. Collagen biosynthesis and modifying enzymes.
REACT_199055. Collagen degradation.

Miscellaneous databases

NextBioi 282294.
PROi Q07563.
SOURCEi Search...

Gene expression databases

Bgeei Q07563.
CleanExi MM_COL17A1.
Genevestigatori Q07563.

Family and domain databases

InterProi IPR008160. Collagen.
[Graphical view ]
Pfami PF01391. Collagen. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of type XVII collagen: complementary and genomic DNA sequences of mouse 180-kDa bullous pemphigoid antigen (BPAG2) predict an interrupted collagenous domain, a transmembrane segment, and unusual features in the 5'-end of the gene and the 3' -."
    Li K., Tamai K., Tan E.M.L., Uitto J.
    J. Biol. Chem. 268:8825-8834(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: BALB/c.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Mammary gland.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1357-1470.
    Strain: C57BL/6J.
    Tissue: Cerebellum.

Entry informationi

Entry nameiCOHA1_MOUSE
AccessioniPrimary (citable) accession number: Q07563
Secondary accession number(s): Q08AT3, Q3UXX1, Q99LK8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: May 1, 2007
Last modified: September 3, 2014
This is version 122 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi