Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q07563 (COHA1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 121. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Collagen alpha-1(XVII) chain
Alternative name(s):
180 kDa bullous pemphigoid antigen 2
Bullous pemphigoid antigen 2

Cleaved into the following chain:

  1. 120 kDa linear IgA disease antigen homolog
Gene names
Name:Col17a1
Synonyms:Bp180, Bpag2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1470 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role in the integrity of hemidesmosome and the attachment of basal keratinocytes to the underlying basement membrane By similarity.

The 120 kDa linear IgA disease antigen homolog is an anchoring filament component involved in dermal-epidermal cohesion By similarity.

Subunit structure

Homotrimers of alpha 1(XVII)chains. Interacts (via cytoplasmic region) with ITGB4 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST (via N-terminus). Interacts (via N-terminus) with PLEC. Interacts (via cytoplasmic region) with DSP By similarity.

Subcellular location

Cell junctionhemidesmosome. Membrane; Single-pass type II membrane protein. Note: Localized along the plasma membrane of the hemidesmosome By similarity.

120 kDa linear IgA disease antigen homolog: Secretedextracellular spaceextracellular matrixbasement membrane By similarity.

Post-translational modification

The intracellular/endo domain is disulfide-linked By similarity.

Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.

The ectodomain is shedded from the surface of keratinocytes resulting in a 120-kDa soluble form, also named as 120 kDa linear IgA disease antigen homolog. The shedding is mediated by membrane-bound metalloproteases. This cleavage is inhibited by phosophorylation at Ser-551 By similarity.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

ELANEP082462EBI-6251005,EBI-986345From a different organism.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q07563-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q07563-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1157-1194: GSDYRNIIGPPGPPGPPGMPGNAWSSISVEDLSSYLHT → A

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 14701470Collagen alpha-1(XVII) chain
PRO_0000059408
Chain531 – 1470940120 kDa linear IgA disease antigen homolog By similarity
PRO_0000342558

Regions

Topological domain1 – 476476Cytoplasmic Potential
Transmembrane477 – 49721Helical; Signal-anchor for type II membrane protein; Potential
Topological domain498 – 1470973Extracellular Potential
Region1 – 573573Nonhelical region (NC16)
Region146 – 23186Necessary for interaction with DST and for the recruitment of DST to hemidesmosome By similarity
Region574 – 1456883Triple-helical region
Region1457 – 147014Nonhelical region (NC1)

Amino acid modifications

Modified residue5511Phosphoserine; by CK2 By similarity
Glycosylation12731N-linked (GlcNAc...) Potential
Glycosylation13951N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1157 – 119438GSDYR…SYLHT → A in isoform 2.
VSP_009362

Experimental info

Sequence conflict1641R → S in AAA37443. Ref.1
Sequence conflict2891A → G in AAA37443. Ref.1
Sequence conflict3241S → C in AAA37443. Ref.1
Sequence conflict12751S → G in AAH03208. Ref.3
Sequence conflict12771N → S in AAA37443. Ref.1
Sequence conflict12771N → S in AAH03208. Ref.3
Sequence conflict12771N → S in AAI25032. Ref.3
Sequence conflict12771N → S in AAI25033. Ref.3
Sequence conflict12921T → I in AAA37443. Ref.1
Sequence conflict12921T → I in AAH03208. Ref.3
Sequence conflict12921T → I in AAI25032. Ref.3
Sequence conflict12921T → I in AAI25033. Ref.3
Sequence conflict13881R → W in AAA37443. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 2007. Version 3.
Checksum: 7C38356D6ED68347

FASTA1,470147,975
        10         20         30         40         50         60 
MDVTKKSKRD GTEVTERIVT ETVTTRLTSL PPKGSTSNGY AKTGSLGGGS RLEKQSLTHG 

        70         80         90        100        110        120 
SSGYINSSGS IRGNASTSSY RRTHSPASTL PNSPGSTFER KAHMTRHGTY EGSSSGNSSP 

       130        140        150        160        170        180 
EYPRKELASS STRGRSQTRE SEIRVRLQSA SPSTRWTELD EVKRLLKGSR SASASPTRNT 

       190        200        210        220        230        240 
SNTLPIPKKG TVETKTVTAS SHSVSGTYDS AILDTNFPPH MWSSTLPAGS SLGTYQNNIT 

       250        260        270        280        290        300 
AQSTSLLNTN AYSTGSVFGV PNNMASCSPT LHPGLSSCSS VFGMQNNLAP SSSVLSHGTT 

       310        320        330        340        350        360 
TASTAYGAKK NVPQPPTVTS TGVSTSATCT TSVQSDDLLH KDCKFLILEK DNTPAKKEME 

       370        380        390        400        410        420 
LLIMTKDSGK VFTASPATIS STSFSEDTLK KEKQAAYAAD TCLKADVNGD LNTVSTKSKM 

       430        440        450        460        470        480 
TSAENHGYDR GGGGGRGKGG GAGGGGGGGG ASGGGGAWGA APAWCPCGSC CSWWKWLLGL 

       490        500        510        520        530        540 
LLTWLLLLGL LFGLIALAEE VRKLKARVEE LEKTKVLYHD VQMDKSNRDR LQAEAPSLGP 

       550        560        570        580        590        600 
GLGKAELDGY SQEAIWLFVR NKLMTEQENG NLRGSPGPKG DMGSQGPKGD RGLPGTPGIP 

       610        620        630        640        650        660 
GPLGHPGPEG PKGQKGSIGD PGMEGPIGQR GLAGPMGPRG EPGPPGSGEK GDRGIAGEQG 

       670        680        690        700        710        720 
PQGLPGVPGP PGLRGHSGSP GPQGPPGAVG PQGLRGDVGL PGVKGDKGLM GPPGPKGDQG 

       730        740        750        760        770        780 
EKGPRGLTGE PGIRGLPGAV GEPGAKGAMG PAGADGQQGS RGEQGLTGMP GTRGPPGPAG 

       790        800        810        820        830        840 
DPGKPGLTGP QGPQGLPGSP GRPGTKGEPG APGRVMTSEG SSTITVPGPP GPPGAMGPPG 

       850        860        870        880        890        900 
PPGTPGPAGP AGLPGQQGPR GEPGLAGDSF LSSGSSISEV LSAQGVDLRG PPGPPGPRGP 

       910        920        930        940        950        960 
PGPSIPGPPG PRGPPGEGVP GPPGPPGSFL TDSETFFTGP PGPPGPPGPK GDQGDPGVPG 

       970        980        990       1000       1010       1020 
TPGISGGLSH GASSSTLYMQ GPPGPPGPPG PPGSLSSSGQ DIQHYIAEYM QSDNIRTYLS 

      1030       1040       1050       1060       1070       1080 
GVQGPPGPPG PPGPVITITG ETFDYSQLAS QVVSYLRSSG YGAGLSSASS SEDILAMLRR 

      1090       1100       1110       1120       1130       1140 
NDVWQYLRQN LVGPPGPPGP PGVSGDGSLL SLDYGELSRH ILNYMSSSGI SFGHPGPPGP 

      1150       1160       1170       1180       1190       1200 
PGLPGTSYEE LLTMLRGSDY RNIIGPPGPP GPPGMPGNAW SSISVEDLSS YLHTAGLSSI 

      1210       1220       1230       1240       1250       1260 
PGPPGPPGPP GPRGPPGVSA ALSTYAAENS DNFRSELISY LTSPDVRSFI VGPPGPPGPQ 

      1270       1280       1290       1300       1310       1320 
GPPGDGHLRE NYNWSSNSSA RRGTSYSSST GTGGTNGGSL GEGGAYGAGD GGPYGTDIGP 

      1330       1340       1350       1360       1370       1380 
GGGYGAAAGG GIYGTNGDSF RDGFTGDLDY NKLAVRVSES MQRQGLLQGM AYTVQGPPGP 

      1390       1400       1410       1420       1430       1440 
QGPPGISRVF SAYSNVTQDL MDFFQTYGTI PGPPGQKGDV GTPGPKGDRG PAGPRGPPGP 

      1450       1460       1470 
PGPRGNKGEK GDKGDQVYTG RRKRSIAIKP 

« Hide

Isoform 2 [UniParc].

Checksum: 0C8997CF58634BA1
Show »

FASTA1,433144,140

References

« Hide 'large scale' references
[1]"Cloning of type XVII collagen: complementary and genomic DNA sequences of mouse 180-kDa bullous pemphigoid antigen (BPAG2) predict an interrupted collagenous domain, a transmembrane segment, and unusual features in the 5'-end of the gene and the 3' -."
Li K., Tamai K., Tan E.M.L., Uitto J.
J. Biol. Chem. 268:8825-8834(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Strain: BALB/c.
[2]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Mammary gland.
[4]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1357-1470.
Strain: C57BL/6J.
Tissue: Cerebellum.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L08407 mRNA. Translation: AAA37443.1.
AC131719 Genomic DNA. No translation available.
BC003208 mRNA. Translation: AAH03208.1.
BC125031 mRNA. Translation: AAI25032.1.
BC125032 mRNA. Translation: AAI25033.1.
AK135150 mRNA. Translation: BAE22442.1.
CCDSCCDS38018.1. [Q07563-2]
PIRA46053.
RefSeqNP_001277754.1. NM_001290825.1. [Q07563-1]
NP_031758.2. NM_007732.2. [Q07563-2]
UniGeneMm.1225.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ07563. 1 interaction.

PTM databases

PhosphoSiteQ07563.

Proteomic databases

PaxDbQ07563.
PRIDEQ07563.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000026045; ENSMUSP00000026045; ENSMUSG00000025064. [Q07563-1]
ENSMUST00000086923; ENSMUSP00000084141; ENSMUSG00000025064. [Q07563-2]
GeneID12821.
KEGGmmu:12821.
UCSCuc008hvi.2. mouse. [Q07563-2]
uc008hvj.2. mouse. [Q07563-1]

Organism-specific databases

CTD1308.
MGIMGI:88450. Col17a1.

Phylogenomic databases

eggNOGNOG309396.
GeneTreeENSGT00740000115363.
HOGENOMHOG000111885.
HOVERGENHBG051065.
InParanoidQ07563.
KOK07603.
OMALLHKDCK.
OrthoDBEOG76QFJV.
PhylomeDBQ07563.
TreeFamTF332289.

Gene expression databases

BgeeQ07563.
CleanExMM_COL17A1.
GenevestigatorQ07563.

Family and domain databases

InterProIPR008160. Collagen.
[Graphical view]
PfamPF01391. Collagen. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio282294.
PROQ07563.
SOURCESearch...

Entry information

Entry nameCOHA1_MOUSE
AccessionPrimary (citable) accession number: Q07563
Secondary accession number(s): Q08AT3, Q3UXX1, Q99LK8
Entry history
Integrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: May 1, 2007
Last modified: July 9, 2014
This is version 121 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot