Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q07563

- COHA1_MOUSE

UniProt

Q07563 - COHA1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Collagen alpha-1(XVII) chain

Gene

Col17a1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play a role in the integrity of hemidesmosome and the attachment of basal keratinocytes to the underlying basement membrane.By similarity
The 120 kDa linear IgA disease antigen homolog is an anchoring filament component involved in dermal-epidermal cohesion.By similarity

GO - Biological processi

  1. hemidesmosome assembly Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_198984. Collagen biosynthesis and modifying enzymes.
REACT_199046. Assembly of collagen fibrils and other multimeric structures.
REACT_199055. Collagen degradation.
REACT_262098. Type I hemidesmosome assembly.

Names & Taxonomyi

Protein namesi
Recommended name:
Collagen alpha-1(XVII) chain
Alternative name(s):
180 kDa bullous pemphigoid antigen 2
Bullous pemphigoid antigen 2
Cleaved into the following chain:
Gene namesi
Name:Col17a1
Synonyms:Bp180, Bpag2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 19

Organism-specific databases

MGIiMGI:88450. Col17a1.

Subcellular locationi

Cell junctionhemidesmosome. Membrane; Single-pass type II membrane protein
Note: Localized along the plasma membrane of the hemidesmosome.By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 476476CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei477 – 49721Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST
Topological domaini498 – 1470973ExtracellularSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. basement membrane Source: UniProtKB-KW
  2. collagen trimer Source: UniProtKB-KW
  3. hemidesmosome Source: MGI
  4. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Basement membrane, Cell junction, Extracellular matrix, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14701470Collagen alpha-1(XVII) chainPRO_0000059408Add
BLAST
Chaini531 – 1470940120 kDa linear IgA disease antigen homologBy similarityPRO_0000342558Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei551 – 5511Phosphoserine; by CK2By similarity
Glycosylationi1273 – 12731N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1395 – 13951N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

The intracellular/endo domain is disulfide-linked.By similarity
Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.
The ectodomain is shedded from the surface of keratinocytes resulting in a 120-kDa soluble form, also named as 120 kDa linear IgA disease antigen homolog. The shedding is mediated by membrane-bound metalloproteases. This cleavage is inhibited by phosophorylation at Ser-551 (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Hydroxylation, Phosphoprotein

Proteomic databases

PaxDbiQ07563.
PRIDEiQ07563.

PTM databases

PhosphoSiteiQ07563.

Expressioni

Gene expression databases

BgeeiQ07563.
CleanExiMM_COL17A1.
GenevestigatoriQ07563.

Interactioni

Subunit structurei

Homotrimers of alpha 1(XVII)chains. Interacts (via cytoplasmic region) with ITGB4 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST (via N-terminus). Interacts (via N-terminus) with PLEC. Interacts (via cytoplasmic region) with DSP (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
ELANEP082462EBI-6251005,EBI-986345From a different organism.

Protein-protein interaction databases

IntActiQ07563. 1 interaction.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 573573Nonhelical region (NC16)Add
BLAST
Regioni146 – 23186Necessary for interaction with DST and for the recruitment of DST to hemidesmosomeBy similarityAdd
BLAST
Regioni574 – 1456883Triple-helical regionAdd
BLAST
Regioni1457 – 147014Nonhelical region (NC1)Add
BLAST

Keywords - Domaini

Collagen, Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG309396.
GeneTreeiENSGT00760000119051.
HOGENOMiHOG000111885.
HOVERGENiHBG051065.
InParanoidiQ07563.
KOiK07603.
OMAiLLHKDCK.
OrthoDBiEOG76QFJV.
PhylomeDBiQ07563.
TreeFamiTF332289.

Family and domain databases

InterProiIPR008160. Collagen.
[Graphical view]
PfamiPF01391. Collagen. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q07563-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVTKKSKRD GTEVTERIVT ETVTTRLTSL PPKGSTSNGY AKTGSLGGGS
60 70 80 90 100
RLEKQSLTHG SSGYINSSGS IRGNASTSSY RRTHSPASTL PNSPGSTFER
110 120 130 140 150
KAHMTRHGTY EGSSSGNSSP EYPRKELASS STRGRSQTRE SEIRVRLQSA
160 170 180 190 200
SPSTRWTELD EVKRLLKGSR SASASPTRNT SNTLPIPKKG TVETKTVTAS
210 220 230 240 250
SHSVSGTYDS AILDTNFPPH MWSSTLPAGS SLGTYQNNIT AQSTSLLNTN
260 270 280 290 300
AYSTGSVFGV PNNMASCSPT LHPGLSSCSS VFGMQNNLAP SSSVLSHGTT
310 320 330 340 350
TASTAYGAKK NVPQPPTVTS TGVSTSATCT TSVQSDDLLH KDCKFLILEK
360 370 380 390 400
DNTPAKKEME LLIMTKDSGK VFTASPATIS STSFSEDTLK KEKQAAYAAD
410 420 430 440 450
TCLKADVNGD LNTVSTKSKM TSAENHGYDR GGGGGRGKGG GAGGGGGGGG
460 470 480 490 500
ASGGGGAWGA APAWCPCGSC CSWWKWLLGL LLTWLLLLGL LFGLIALAEE
510 520 530 540 550
VRKLKARVEE LEKTKVLYHD VQMDKSNRDR LQAEAPSLGP GLGKAELDGY
560 570 580 590 600
SQEAIWLFVR NKLMTEQENG NLRGSPGPKG DMGSQGPKGD RGLPGTPGIP
610 620 630 640 650
GPLGHPGPEG PKGQKGSIGD PGMEGPIGQR GLAGPMGPRG EPGPPGSGEK
660 670 680 690 700
GDRGIAGEQG PQGLPGVPGP PGLRGHSGSP GPQGPPGAVG PQGLRGDVGL
710 720 730 740 750
PGVKGDKGLM GPPGPKGDQG EKGPRGLTGE PGIRGLPGAV GEPGAKGAMG
760 770 780 790 800
PAGADGQQGS RGEQGLTGMP GTRGPPGPAG DPGKPGLTGP QGPQGLPGSP
810 820 830 840 850
GRPGTKGEPG APGRVMTSEG SSTITVPGPP GPPGAMGPPG PPGTPGPAGP
860 870 880 890 900
AGLPGQQGPR GEPGLAGDSF LSSGSSISEV LSAQGVDLRG PPGPPGPRGP
910 920 930 940 950
PGPSIPGPPG PRGPPGEGVP GPPGPPGSFL TDSETFFTGP PGPPGPPGPK
960 970 980 990 1000
GDQGDPGVPG TPGISGGLSH GASSSTLYMQ GPPGPPGPPG PPGSLSSSGQ
1010 1020 1030 1040 1050
DIQHYIAEYM QSDNIRTYLS GVQGPPGPPG PPGPVITITG ETFDYSQLAS
1060 1070 1080 1090 1100
QVVSYLRSSG YGAGLSSASS SEDILAMLRR NDVWQYLRQN LVGPPGPPGP
1110 1120 1130 1140 1150
PGVSGDGSLL SLDYGELSRH ILNYMSSSGI SFGHPGPPGP PGLPGTSYEE
1160 1170 1180 1190 1200
LLTMLRGSDY RNIIGPPGPP GPPGMPGNAW SSISVEDLSS YLHTAGLSSI
1210 1220 1230 1240 1250
PGPPGPPGPP GPRGPPGVSA ALSTYAAENS DNFRSELISY LTSPDVRSFI
1260 1270 1280 1290 1300
VGPPGPPGPQ GPPGDGHLRE NYNWSSNSSA RRGTSYSSST GTGGTNGGSL
1310 1320 1330 1340 1350
GEGGAYGAGD GGPYGTDIGP GGGYGAAAGG GIYGTNGDSF RDGFTGDLDY
1360 1370 1380 1390 1400
NKLAVRVSES MQRQGLLQGM AYTVQGPPGP QGPPGISRVF SAYSNVTQDL
1410 1420 1430 1440 1450
MDFFQTYGTI PGPPGQKGDV GTPGPKGDRG PAGPRGPPGP PGPRGNKGEK
1460 1470
GDKGDQVYTG RRKRSIAIKP
Length:1,470
Mass (Da):147,975
Last modified:May 1, 2007 - v3
Checksum:i7C38356D6ED68347
GO
Isoform 2 (identifier: Q07563-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1157-1194: GSDYRNIIGPPGPPGPPGMPGNAWSSISVEDLSSYLHT → A

Show »
Length:1,433
Mass (Da):144,140
Checksum:i0C8997CF58634BA1
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti164 – 1641R → S in AAA37443. (PubMed:8473327)Curated
Sequence conflicti289 – 2891A → G in AAA37443. (PubMed:8473327)Curated
Sequence conflicti324 – 3241S → C in AAA37443. (PubMed:8473327)Curated
Sequence conflicti1275 – 12751S → G in AAH03208. (PubMed:15489334)Curated
Sequence conflicti1277 – 12771N → S in AAA37443. (PubMed:8473327)Curated
Sequence conflicti1277 – 12771N → S in AAH03208. (PubMed:15489334)Curated
Sequence conflicti1277 – 12771N → S in AAI25032. (PubMed:15489334)Curated
Sequence conflicti1277 – 12771N → S in AAI25033. (PubMed:15489334)Curated
Sequence conflicti1292 – 12921T → I in AAA37443. (PubMed:8473327)Curated
Sequence conflicti1292 – 12921T → I in AAH03208. (PubMed:15489334)Curated
Sequence conflicti1292 – 12921T → I in AAI25032. (PubMed:15489334)Curated
Sequence conflicti1292 – 12921T → I in AAI25033. (PubMed:15489334)Curated
Sequence conflicti1388 – 13881R → W in AAA37443. (PubMed:8473327)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1157 – 119438GSDYR…SYLHT → A in isoform 2. 1 PublicationVSP_009362Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L08407 mRNA. Translation: AAA37443.1.
AC131719 Genomic DNA. No translation available.
BC003208 mRNA. Translation: AAH03208.1.
BC125031 mRNA. Translation: AAI25032.1.
BC125032 mRNA. Translation: AAI25033.1.
AK135150 mRNA. Translation: BAE22442.1.
CCDSiCCDS38018.1. [Q07563-2]
CCDS70959.1. [Q07563-1]
PIRiA46053.
RefSeqiNP_001277754.1. NM_001290825.1. [Q07563-1]
NP_031758.2. NM_007732.2. [Q07563-2]
UniGeneiMm.1225.

Genome annotation databases

EnsembliENSMUST00000026045; ENSMUSP00000026045; ENSMUSG00000025064. [Q07563-1]
ENSMUST00000086923; ENSMUSP00000084141; ENSMUSG00000025064. [Q07563-2]
GeneIDi12821.
KEGGimmu:12821.
UCSCiuc008hvi.2. mouse. [Q07563-2]
uc008hvj.2. mouse. [Q07563-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L08407 mRNA. Translation: AAA37443.1 .
AC131719 Genomic DNA. No translation available.
BC003208 mRNA. Translation: AAH03208.1 .
BC125031 mRNA. Translation: AAI25032.1 .
BC125032 mRNA. Translation: AAI25033.1 .
AK135150 mRNA. Translation: BAE22442.1 .
CCDSi CCDS38018.1. [Q07563-2 ]
CCDS70959.1. [Q07563-1 ]
PIRi A46053.
RefSeqi NP_001277754.1. NM_001290825.1. [Q07563-1 ]
NP_031758.2. NM_007732.2. [Q07563-2 ]
UniGenei Mm.1225.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q07563. 1 interaction.

PTM databases

PhosphoSitei Q07563.

Proteomic databases

PaxDbi Q07563.
PRIDEi Q07563.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000026045 ; ENSMUSP00000026045 ; ENSMUSG00000025064 . [Q07563-1 ]
ENSMUST00000086923 ; ENSMUSP00000084141 ; ENSMUSG00000025064 . [Q07563-2 ]
GeneIDi 12821.
KEGGi mmu:12821.
UCSCi uc008hvi.2. mouse. [Q07563-2 ]
uc008hvj.2. mouse. [Q07563-1 ]

Organism-specific databases

CTDi 1308.
MGIi MGI:88450. Col17a1.

Phylogenomic databases

eggNOGi NOG309396.
GeneTreei ENSGT00760000119051.
HOGENOMi HOG000111885.
HOVERGENi HBG051065.
InParanoidi Q07563.
KOi K07603.
OMAi LLHKDCK.
OrthoDBi EOG76QFJV.
PhylomeDBi Q07563.
TreeFami TF332289.

Enzyme and pathway databases

Reactomei REACT_198984. Collagen biosynthesis and modifying enzymes.
REACT_199046. Assembly of collagen fibrils and other multimeric structures.
REACT_199055. Collagen degradation.
REACT_262098. Type I hemidesmosome assembly.

Miscellaneous databases

NextBioi 282294.
PROi Q07563.
SOURCEi Search...

Gene expression databases

Bgeei Q07563.
CleanExi MM_COL17A1.
Genevestigatori Q07563.

Family and domain databases

InterProi IPR008160. Collagen.
[Graphical view ]
Pfami PF01391. Collagen. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of type XVII collagen: complementary and genomic DNA sequences of mouse 180-kDa bullous pemphigoid antigen (BPAG2) predict an interrupted collagenous domain, a transmembrane segment, and unusual features in the 5'-end of the gene and the 3' -."
    Li K., Tamai K., Tan E.M.L., Uitto J.
    J. Biol. Chem. 268:8825-8834(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: BALB/c.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Mammary gland.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1357-1470.
    Strain: C57BL/6J.
    Tissue: Cerebellum.

Entry informationi

Entry nameiCOHA1_MOUSE
AccessioniPrimary (citable) accession number: Q07563
Secondary accession number(s): Q08AT3, Q3UXX1, Q99LK8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: May 1, 2007
Last modified: November 26, 2014
This is version 125 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3