Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NKG2-E type II integral membrane protein

Gene

KLRC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

GO - Molecular functioni

  • carbohydrate binding Source: UniProtKB-KW
  • transmembrane signaling receptor activity Source: ProtInc

GO - Biological processi

  • cellular defense response Source: ProtInc
  • signal transduction Source: GOC
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

Lectin

Names & Taxonomyi

Protein namesi
Recommended name:
NKG2-E type II integral membrane protein
Alternative name(s):
NK cell receptor E
NKG2-E-activating NK receptor
Gene namesi
Name:KLRC3
Synonyms:NKG2E
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:6376. KLRC3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 7070CytoplasmicSequence analysisAdd
BLAST
Transmembranei71 – 9323Helical; Signal-anchor for type II membrane proteinSequence analysisAdd
BLAST
Topological domaini94 – 240147ExtracellularSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30165.

Polymorphism and mutation databases

BioMutaiKLRC3.
DMDMi296439288.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 240240NKG2-E type II integral membrane proteinPRO_0000046671Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi100 – 1001N-linked (GlcNAc...)Sequence analysis
Disulfide bondi117 ↔ 128PROSITE-ProRule annotation
Glycosylationi149 – 1491N-linked (GlcNAc...)Sequence analysis
Glycosylationi179 – 1791N-linked (GlcNAc...)Sequence analysis
Disulfide bondi207 ↔ 220PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ07444.
PRIDEiQ07444.

Expressioni

Tissue specificityi

Natural killer cells.

Gene expression databases

BgeeiQ07444.
CleanExiHS_KLRC3.
GenevisibleiQ07444. HS.

Organism-specific databases

HPAiHPA062570.

Interactioni

Subunit structurei

Can form disulfide-bonded heterodimer with CD94.

Protein-protein interaction databases

BioGridi110022. 1 interaction.
IntActiQ07444. 1 interaction.
STRINGi9606.ENSP00000437563.

Structurei

3D structure databases

ProteinModelPortaliQ07444.
SMRiQ07444. Positions 72-99, 111-225.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini116 – 230115C-type lectinPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 C-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IWW4. Eukaryota.
ENOG410ZFTY. LUCA.
GeneTreeiENSGT00730000110282.
HOGENOMiHOG000220925.
HOVERGENiHBG077044.
InParanoidiQ07444.
KOiK06541.
OMAiRNDIMIA.
OrthoDBiEOG76HQ2G.
PhylomeDBiQ07444.
TreeFamiTF336674.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR016187. C-type_lectin_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform NKG2-E (identifier: Q07444-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSKQRGTFSE VSLAQDPKWQ QRKPKGNKSS ISGTEQEIFQ VELNLQNASL
60 70 80 90 100
NHQGIDKIYD CQGLLPPPEK LTAEVLGIIC IVLMATVLKT IVLIPFLEQN
110 120 130 140 150
NSSPNARTQK ARHCGHCPEE WITYSNSCYY IGKERRTWEE SLQACASKNS
160 170 180 190 200
SSLLCIDNEE EMKFLASILP SSWIGVFRNS SHHPWVTING LAFKHEIKDS
210 220 230 240
DHAERNCAML HVRGLISDQC GSSRIIRRGF IMLTRLVLNS
Length:240
Mass (Da):27,100
Last modified:May 18, 2010 - v3
Checksum:i9F7056DD558A40C3
GO
Isoform NKG2-H (identifier: Q07444-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-240: RRGFIMLTRLVLNS → VSISFRIKALELAVHQIKFYICSNRNDIMIA

Show »
Length:257
Mass (Da):29,018
Checksum:i1DFECB6179F43783
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti48 – 481A → P in AAL65232 (Ref. 5) Curated
Sequence conflicti134 – 1341E → G in AAL65232 (Ref. 5) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti2 – 21S → N.4 Publications
Corresponds to variant rs2682489 [ dbSNP | Ensembl ].
VAR_062954
Natural varianti19 – 191W → P in allele NKG2-E*01 and allele NKG2-E*03; requires 2 nucleotide substitutions. 3 Publications
VAR_013296
Natural varianti19 – 191W → R in allele NKG2-E*02. 2 Publications
Corresponds to variant rs2682490 [ dbSNP | Ensembl ].
VAR_063132
Natural varianti106 – 1061A → T.4 Publications
Corresponds to variant rs28626640 [ dbSNP | Ensembl ].
VAR_063133
Natural varianti113 – 1131H → P.5 Publications
Corresponds to variant rs2682494 [ dbSNP | Ensembl ].
VAR_062955
Natural varianti135 – 1351R → S.
Corresponds to variant rs1138437 [ dbSNP | Ensembl ].
VAR_014660
Natural varianti155 – 1551C → S.4 Publications
Corresponds to variant rs2682495 [ dbSNP | Ensembl ].
VAR_062956

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei227 – 24014RRGFI…LVLNS → VSISFRIKALELAVHQIKFY ICSNRNDIMIA in isoform NKG2-H. 1 PublicationVSP_003067Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L14542 mRNA. Translation: AAA16833.1.
AJ001685 Genomic DNA. Translation: CAA04923.1.
AF078550 mRNA. Translation: AAD46108.1.
AF350016 mRNA. Translation: AAK83803.1.
AF350017 mRNA. Translation: AAK83804.1.
AF461157 mRNA. Translation: AAL65232.1.
AC022075 Genomic DNA. No translation available.
AC068775 Genomic DNA. No translation available.
CCDSiCCDS31744.1. [Q07444-2]
CCDS41755.1. [Q07444-1]
PIRiI54524.
RefSeqiNP_002252.2. NM_002261.2. [Q07444-1]
NP_031359.2. NM_007333.2. [Q07444-2]
UniGeneiHs.654362.

Genome annotation databases

EnsembliENST00000381903; ENSP00000371328; ENSG00000205810. [Q07444-2]
ENST00000396439; ENSP00000379716; ENSG00000205810. [Q07444-1]
GeneIDi3823.
KEGGihsa:3823.
UCSCiuc001qyf.4. human. [Q07444-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

NKG-2E

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L14542 mRNA. Translation: AAA16833.1.
AJ001685 Genomic DNA. Translation: CAA04923.1.
AF078550 mRNA. Translation: AAD46108.1.
AF350016 mRNA. Translation: AAK83803.1.
AF350017 mRNA. Translation: AAK83804.1.
AF461157 mRNA. Translation: AAL65232.1.
AC022075 Genomic DNA. No translation available.
AC068775 Genomic DNA. No translation available.
CCDSiCCDS31744.1. [Q07444-2]
CCDS41755.1. [Q07444-1]
PIRiI54524.
RefSeqiNP_002252.2. NM_002261.2. [Q07444-1]
NP_031359.2. NM_007333.2. [Q07444-2]
UniGeneiHs.654362.

3D structure databases

ProteinModelPortaliQ07444.
SMRiQ07444. Positions 72-99, 111-225.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110022. 1 interaction.
IntActiQ07444. 1 interaction.
STRINGi9606.ENSP00000437563.

Polymorphism and mutation databases

BioMutaiKLRC3.
DMDMi296439288.

Proteomic databases

PaxDbiQ07444.
PRIDEiQ07444.

Protocols and materials databases

DNASUi3823.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000381903; ENSP00000371328; ENSG00000205810. [Q07444-2]
ENST00000396439; ENSP00000379716; ENSG00000205810. [Q07444-1]
GeneIDi3823.
KEGGihsa:3823.
UCSCiuc001qyf.4. human. [Q07444-1]

Organism-specific databases

CTDi3823.
GeneCardsiKLRC3.
HGNCiHGNC:6376. KLRC3.
HPAiHPA062570.
MIMi602892. gene.
neXtProtiNX_Q07444.
PharmGKBiPA30165.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IWW4. Eukaryota.
ENOG410ZFTY. LUCA.
GeneTreeiENSGT00730000110282.
HOGENOMiHOG000220925.
HOVERGENiHBG077044.
InParanoidiQ07444.
KOiK06541.
OMAiRNDIMIA.
OrthoDBiEOG76HQ2G.
PhylomeDBiQ07444.
TreeFamiTF336674.

Miscellaneous databases

GenomeRNAii3823.
NextBioi15029.
PROiQ07444.
SOURCEiSearch...

Gene expression databases

BgeeiQ07444.
CleanExiHS_KLRC3.
GenevisibleiQ07444. HS.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR016187. C-type_lectin_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Natural killer lectin-like receptors have divergent carboxy-termini, distinct from C-type lectins."
    Adamkiewicz T.V., McSherry C., Bach F.H., Houchins J.P.
    Immunogenetics 39:218-218(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM NKG2-E), VARIANTS ASN-2; PRO-19; THR-106; PRO-113 AND SER-155.
  2. "The genomic organization of NKG2C, E, F, and D receptor genes in the human natural killer gene complex."
    Glienke J., Sobanov Y., Brostjan C., Steffens C., Nguyen C., Lehrach H., Hofer E., Francis F.
    Immunogenetics 48:163-173(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM NKG2-E), VARIANTS ASN-2; PRO-19; PRO-113 AND SER-155.
  3. "Triggering of effector functions on a CD8+ T cell clone upon the aggregation of an activatory CD94/kp39 heterodimer."
    Bellon T., Heredia A.B., Llano M., Minguela A., Rodriguez A., Lopez-Botet M., Aparicio P.
    J. Immunol. 162:3996-4002(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM NKG2-H), VARIANTS ASN-2; PRO-19; THR-106 AND PRO-113.
  4. "Conservation and variation in human and common chimpanzee CD94 and NKG2 genes."
    Shum B.P., Flodin L.R., Muir D.G., Rajalingam R., Khakoo S.I., Cleland S., Guethlein L.A., Uhrberg M., Parham P.
    J. Immunol. 168:240-252(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM NKG2-E), VARIANTS ASN-2; ARG-19; THR-106; PRO-113 AND SER-155.
  5. "Identification of the NKG2E gene in large granular lymphocytic leukemia (LGL)."
    Kothapalli R., Kusmartseva I., Loughran T.P. Jr.
    Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANTS ARG-19; THR-106; PRO-113 AND SER-155.
  6. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiNKG2E_HUMAN
AccessioniPrimary (citable) accession number: Q07444
Secondary accession number(s): Q8WXA4, Q96RL0, Q9UP04
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 18, 2010
Last modified: March 16, 2016
This is version 138 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.