Q07444 (NKG2E_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: NKG2-E type II integral membrane protein Alternative name(s): NK cell receptor E NKG2-E-activating NK receptor | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 240 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. |
| Subunit structure | Can form disulfide-bonded heterodimer with CD94. |
| Subcellular location | |
| Tissue specificity | Natural killer cells. |
| Sequence similarities | Contains 1 C-type lectin domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Ligand | Lectin |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cellular defense response Traceable author statement. Source: ProtInc |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | sugar binding Inferred from electronic annotation. Source: UniProtKB-KW transmembrane signaling receptor activityTraceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform NKG2-E (identifier: Q07444-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform NKG2-H (identifier: Q07444-2) The sequence of this isoform differs from the canonical sequence as follows: 227-240: RRGFIMLTRLVLNS → VSISFRIKALELAVHQIKFYICSNRNDIMIA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 240 | 240 | NKG2-E type II integral membrane protein | PRO_0000046671 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 70 | 70 | Cytoplasmic Potential | ||||||||
| Transmembrane | 71 – 93 | 23 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 94 – 240 | 147 | Extracellular Potential | ||||||||
| Domain | 116 – 230 | 115 | C-type lectin | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 100 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 149 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 179 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 117 ↔ 128 | By similarity | |||||||||
| Disulfide bond | 207 ↔ 220 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 227 – 240 | 14 | RRGFI…LVLNS → VSISFRIKALELAVHQIKFY ICSNRNDIMIA in isoform NKG2-H. | VSP_003067 | |||||||
| Natural variant | 2 | 1 | S → N. Ref.1 Ref.2 Ref.3 Ref.4 Corresponds to variant rs2682489 [ dbSNP | Ensembl ]. | VAR_062954 | |||||||
| Natural variant | 19 | 1 | W → P in allele NKG2-E*01 and allele NKG2-E*03; requires 2 nucleotide substitutions. Ref.1 Ref.2 Ref.3 | VAR_013296 | |||||||
| Natural variant | 19 | 1 | W → R in allele NKG2-E*02. Ref.4 Ref.5 | VAR_063132 | |||||||
| Natural variant | 106 | 1 | A → T. Ref.1 Ref.3 Ref.4 Ref.5 Corresponds to variant rs28626640 [ dbSNP | Ensembl ]. | VAR_063133 | |||||||
| Natural variant | 113 | 1 | H → P. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Corresponds to variant rs2682494 [ dbSNP | Ensembl ]. | VAR_062955 | |||||||
| Natural variant | 135 | 1 | R → S. Corresponds to variant rs1138437 [ dbSNP | Ensembl ]. | VAR_014660 | |||||||
| Natural variant | 155 | 1 | C → S. Ref.1 Ref.2 Ref.4 Ref.5 Corresponds to variant rs2682495 [ dbSNP | Ensembl ]. | VAR_062956 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 48 | 1 | A → P in AAL65232. Ref.5 | ||||||||
| Sequence conflict | 134 | 1 | E → G in AAL65232. Ref.5 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Natural killer lectin-like receptors have divergent carboxy-termini, distinct from C-type lectins." Adamkiewicz T.V., McSherry C., Bach F.H., Houchins J.P. Immunogenetics 39:218-218(1994) [PubMed: 8276468] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM NKG2-E), VARIANTS ASN-2; PRO-19; THR-106; PRO-113 AND SER-155. |
| [2] | "The genomic organization of NKG2C, E, F, and D receptor genes in the human natural killer gene complex." Glienke J., Sobanov Y., Brostjan C., Steffens C., Nguyen C., Lehrach H., Hofer E., Francis F. Immunogenetics 48:163-173(1998) [PubMed: 9683661] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM NKG2-E), VARIANTS ASN-2; PRO-19; PRO-113 AND SER-155. |
| [3] | "Triggering of effector functions on a CD8+ T cell clone upon the aggregation of an activatory CD94/kp39 heterodimer." Bellon T., Heredia A.B., Llano M., Minguela A., Rodriguez A., Lopez-Botet M., Aparicio P. J. Immunol. 162:3996-4002(1999) [PubMed: 10201920] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM NKG2-H), VARIANTS ASN-2; PRO-19; THR-106 AND PRO-113. |
| [4] | "Conservation and variation in human and common chimpanzee CD94 and NKG2 genes." Shum B.P., Flodin L.R., Muir D.G., Rajalingam R., Khakoo S.I., Cleland S., Guethlein L.A., Uhrberg M., Parham P. J. Immunol. 168:240-252(2002) [PubMed: 11751968] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM NKG2-E), VARIANTS ASN-2; ARG-19; THR-106; PRO-113 AND SER-155. |
| [5] | "Identification of the NKG2E gene in large granular lymphocytic leukemia (LGL)." Kothapalli R., Kusmartseva I., Loughran T.P. Jr. Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANTS ARG-19; THR-106; PRO-113 AND SER-155. |
| [6] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed: 16541075] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L14542 mRNA. Translation: AAA16833.1. AJ001685 Genomic DNA. Translation: CAA04923.1. AF078550 mRNA. Translation: AAD46108.1. AF350016 mRNA. Translation: AAK83803.1. AF350017 mRNA. Translation: AAK83804.1. AF461157 mRNA. Translation: AAL65232.1. AC022075 Genomic DNA. No translation available. AC068775 Genomic DNA. No translation available. |
| IPI | IPI00017478. IPI00219135. |
| PIR | I54524. |
| RefSeq | NP_002252.2. NM_002261.2. NP_031359.2. NM_007333.2. XP_003403690.1. XM_003403642.1. |
| UniGene | Hs.654362. |
3D structure databases | |
| ProteinModelPortal | Q07444. |
| SMR | Q07444. Positions 72-99, 111-225. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q07444. 1 interaction. |
| STRING | Q07444. |
Polymorphism databases | |
| DMDM | 296439288. |
Proteomic databases | |
| PRIDE | Q07444. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000381904; ENSP00000371329; ENSG00000205810. |
| GeneID | 3822. 3823. |
| KEGG | hsa:3822. hsa:3823. |
| UCSC | uc001qyf.1. human. uc001qyi.1. human. |
Organism-specific databases | |
| CTD | 3822. 3823. |
| GeneCards | GC12M010564. |
| H-InvDB | HIX0201919. |
| HGNC | HGNC:6376. KLRC3. |
| MIM | 602892. gene. |
| neXtProt | NX_Q07444. |
| PharmGKB | PA30165. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG04679. |
| HOVERGEN | HBG077044. |
Gene expression databases | |
| ArrayExpress | Q07444. |
| Bgee | Q07444. |
| CleanEx | HS_KLRC3. |
| Genevestigator | Q07444. |
| GermOnline | ENSG00000205810. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001304. C-type_lectin. IPR016186. C-type_lectin-like. IPR016187. C-type_lectin_fold. [Graphical view] |
| Gene3D | G3DSA:3.10.100.10. C-type_lectin-like. 1 hit. |
| KO | K06541. |
| Pfam | PF00059. Lectin_C. 1 hit. [Graphical view] |
| SMART | SM00034. CLECT. 1 hit. [Graphical view] |
| SUPFAM | SSF56436. C-type_lectin_fold. 1 hit. |
| PROSITE | PS00615. C_TYPE_LECTIN_1. False negative. PS50041. C_TYPE_LECTIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 15033. |
| SOURCE | Search... |
Entry information
| Entry name | NKG2E_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q07444 Secondary accession number(s): Q8WXA4, Q96RL0, Q9UP04 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with