Reviewed,
UniProtKB/Swiss-Prot Q07444 (NKG2E_HUMAN)
Last modified
May 5, 2009.
Version 82.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: NKG2-E type II integral membrane protein Alternative name(s): NKG2-E-activating NK receptor NK cell receptor E | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 240 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. |
| Subunit structure | Can form disulfide-bonded heterodimer with CD94. |
| Subcellular location | |
| Tissue specificity | Natural killer cells. |
| Sequence similarities | Contains 1 C-type lectin domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal-anchor Transmembrane |
| Ligand | Lectin |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Gene Ontology (GO) | |
| Biological process | cellular defense response Ref.2 Traceable author statement. Source: ProtInc |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | sugar binding Inferred from electronic annotation. Source: UniProtKB-KW transmembrane receptor activity Ref.2Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform NKG2-E (identifier: Q07444-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform NKG2-H (identifier: Q07444-2) The sequence of this isoform differs from the canonical sequence as follows: 227-240: RRGFIMLTRLVLNS → VSISFRIKALELAVHQIKFYICSNRNDIMIA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 240 | 240 | NKG2-E type II integral membrane protein | PRO_0000046671 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 70 | 70 | Cytoplasmic Potential | ||||||||
| Transmembrane | 71 – 93 | 23 | Signal-anchor for type II membrane protein Potential | ||||||||
| Topological domain | 94 – 240 | 147 | Extracellular Potential | ||||||||
| Domain | 116 – 230 | 115 | C-type lectin | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 100 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 149 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 179 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 117 ↔ 128 | By similarity | |||||||||
| Disulfide bond | 207 ↔ 220 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 227 – 240 | 14 | RRGFI…LVLNS → VSISFRIKALELAVHQIKFY ICSNRNDIMIA in isoform NKG2-H. | VSP_003067 | |||||||
| Natural variant | 19 | 1 | P → R in allele NKG2-E*02. Ref.4 | VAR_013296 | |||||||
| Natural variant | 135 | 1 | R → S: dbSNP rs1138437. | VAR_014660 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Natural killer lectin-like receptors have divergent carboxy-termini, distinct from C-type lectins." Adamkiewicz T.V., McSherry C., Bach F.H., Houchins J.P. Immunogenetics 39:218-218(1994) [PubMed: 8276468] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM NKG2-E). |
| [2] | "The genomic organization of NKG2C, E, F, and D receptor genes in the human natural killer gene complex." Glienke J., Sobanov Y., Brostjan C., Steffens C., Nguyen C., Lehrach H., Hofer E., Francis F. Immunogenetics 48:163-173(1998) [PubMed: 9683661] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM NKG2-E). |
| [3] | "Triggering of effector functions on a CD8+ T cell clone upon the aggregation of an activatory CD94/kp39 heterodimer." Bellon T., Heredia A.B., Llano M., Minguela A., Rodriguez A., Lopez-Botet M., Aparicio P. J. Immunol. 162:3996-4002(1999) [PubMed: 10201920] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM NKG2-H). |
| [4] | "Conservation and variation in human and common chimpanzee CD94 and NKG2 genes." Shum B.P., Flodin L.R., Muir D.G., Rajalingam R., Khakoo S.I., Cleland S., Guethlein L.A., Uhrberg M., Parham P. J. Immunol. 168:240-252(2002) [PubMed: 11751968] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM NKG2-E), VARIANT ARG-19. |
Cross-references
Sequence databases | |
|---|---|
| L14542 mRNA. Translation: AAA16833.1. AJ001685 Genomic DNA. Translation: CAA04923.1. AF078550 mRNA. Translation: AAD46108.1. AF350016 mRNA. Translation: AAK83803.1. AF350017 mRNA. Translation: AAK83804.1. | |
| IPI | IPI00017478. IPI00219135. |
| PIR | I54524. |
| RefSeq | NP_002252.2. NP_031359.2. |
| UniGene | Hs.654362 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1B6E based on UniProtKB Q13241. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q07444. |
Genome annotation databases | |
| Ensembl | ENSG00000205810. Homo sapiens. [Contig view] |
| GeneID | 3823. |
| KEGG | hsa:3823. |
Organism-specific databases | |
| GeneCards | GC12M010456. |
| H-InvDB | HIX0036694. |
| HGNC | HGNC:6376. KLRC3. |
| MIM | 602892. gene. |
| PharmGKB | PA30165. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q07444. |
Gene expression databases | |
| ArrayExpress | Q07444. |
| Bgee | Q07444. |
| CleanEx | HS_KLRC3. |
| GermOnline | ENSG00000205810. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001304. C-type_lectin. IPR016186. C-type_lectin-like. IPR018378. C-type_lectin_CS. [Graphical view] |
| Gene3D | G3DSA:3.10.100.10. C-type_lectin-like. 1 hit. |
| Pfam | PF00059. Lectin_C. 1 hit. [Graphical view] |
| SMART | SM00034. CLECT. 1 hit. [Graphical view] |
| PROSITE | PS00615. C_TYPE_LECTIN_1. False negative. PS50041. C_TYPE_LECTIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 15033. |
| SOURCE | Search... |
Entry information
| Entry name | NKG2E_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q07444 Secondary accession number(s): Q96RL0, Q9UP04 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


