Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NKG2-E type II integral membrane protein

Gene

KLRC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

GO - Molecular functioni

  • carbohydrate binding Source: UniProtKB-KW
  • transmembrane signaling receptor activity Source: ProtInc

GO - Biological processi

  • cellular defense response Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

Lectin

Enzyme and pathway databases

BioCyciZFISH:G66-32452-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
NKG2-E type II integral membrane protein
Alternative name(s):
NK cell receptor E
NKG2-E-activating NK receptor
Gene namesi
Name:KLRC3
Synonyms:NKG2E
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:6376. KLRC3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 70CytoplasmicSequence analysisAdd BLAST70
Transmembranei71 – 93Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST23
Topological domaini94 – 240ExtracellularSequence analysisAdd BLAST147

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000205810.
PharmGKBiPA30165.

Polymorphism and mutation databases

BioMutaiKLRC3.
DMDMi296439288.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000466711 – 240NKG2-E type II integral membrane proteinAdd BLAST240

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi100N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi117 ↔ 128PROSITE-ProRule annotation
Glycosylationi149N-linked (GlcNAc...)Sequence analysis1
Glycosylationi179N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi207 ↔ 220PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ07444.
PRIDEiQ07444.

PTM databases

iPTMnetiQ07444.
PhosphoSitePlusiQ07444.

Expressioni

Tissue specificityi

Natural killer cells.

Gene expression databases

BgeeiENSG00000205810.
CleanExiHS_KLRC3.
GenevisibleiQ07444. HS.

Organism-specific databases

HPAiHPA062570.

Interactioni

Subunit structurei

Can form disulfide-bonded heterodimer with CD94.

Protein-protein interaction databases

BioGridi110022. 2 interactors.
IntActiQ07444. 1 interactor.
STRINGi9606.ENSP00000437563.

Structurei

3D structure databases

ProteinModelPortaliQ07444.
SMRiQ07444.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini116 – 230C-type lectinPROSITE-ProRule annotationAdd BLAST115

Sequence similaritiesi

Contains 1 C-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IWW4. Eukaryota.
ENOG410ZFTY. LUCA.
GeneTreeiENSGT00730000110282.
HOGENOMiHOG000220925.
HOVERGENiHBG077044.
InParanoidiQ07444.
KOiK06541.
OMAiRNDIMIA.
OrthoDBiEOG091G0I60.
PhylomeDBiQ07444.
TreeFamiTF336674.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin-like.
IPR016186. C-type_lectin-like/link.
IPR016187. CTDL_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform NKG2-E (identifier: Q07444-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSKQRGTFSE VSLAQDPKWQ QRKPKGNKSS ISGTEQEIFQ VELNLQNASL
60 70 80 90 100
NHQGIDKIYD CQGLLPPPEK LTAEVLGIIC IVLMATVLKT IVLIPFLEQN
110 120 130 140 150
NSSPNARTQK ARHCGHCPEE WITYSNSCYY IGKERRTWEE SLQACASKNS
160 170 180 190 200
SSLLCIDNEE EMKFLASILP SSWIGVFRNS SHHPWVTING LAFKHEIKDS
210 220 230 240
DHAERNCAML HVRGLISDQC GSSRIIRRGF IMLTRLVLNS
Length:240
Mass (Da):27,100
Last modified:May 18, 2010 - v3
Checksum:i9F7056DD558A40C3
GO
Isoform NKG2-H (identifier: Q07444-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-240: RRGFIMLTRLVLNS → VSISFRIKALELAVHQIKFYICSNRNDIMIA

Show »
Length:257
Mass (Da):29,018
Checksum:i1DFECB6179F43783
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti48A → P in AAL65232 (Ref. 5) Curated1
Sequence conflicti134E → G in AAL65232 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0629542S → N.4 PublicationsCorresponds to variant rs2682489dbSNPEnsembl.1
Natural variantiVAR_01329619W → P in allele NKG2-E*01 and allele NKG2-E*03; requires 2 nucleotide substitutions. 3 PublicationsCorresponds to variant rs796361824dbSNPEnsembl.1
Natural variantiVAR_06313219W → R in allele NKG2-E*02. 2 PublicationsCorresponds to variant rs2682490dbSNPEnsembl.1
Natural variantiVAR_063133106A → T.4 PublicationsCorresponds to variant rs28626640dbSNPEnsembl.1
Natural variantiVAR_062955113H → P.5 PublicationsCorresponds to variant rs2682494dbSNPEnsembl.1
Natural variantiVAR_014660135R → S.Corresponds to variant rs1138437dbSNPEnsembl.1
Natural variantiVAR_062956155C → S.4 PublicationsCorresponds to variant rs2682495dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_003067227 – 240RRGFI…LVLNS → VSISFRIKALELAVHQIKFY ICSNRNDIMIA in isoform NKG2-H. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L14542 mRNA. Translation: AAA16833.1.
AJ001685 Genomic DNA. Translation: CAA04923.1.
AF078550 mRNA. Translation: AAD46108.1.
AF350016 mRNA. Translation: AAK83803.1.
AF350017 mRNA. Translation: AAK83804.1.
AF461157 mRNA. Translation: AAL65232.1.
AC022075 Genomic DNA. No translation available.
AC068775 Genomic DNA. No translation available.
CCDSiCCDS31744.1. [Q07444-2]
CCDS41755.1. [Q07444-1]
PIRiI54524.
RefSeqiNP_002252.2. NM_002261.2. [Q07444-1]
NP_031359.2. NM_007333.2. [Q07444-2]
UniGeneiHs.654362.

Genome annotation databases

EnsembliENST00000381903; ENSP00000371328; ENSG00000205810. [Q07444-2]
ENST00000396439; ENSP00000379716; ENSG00000205810. [Q07444-1]
GeneIDi3823.
KEGGihsa:3823.
UCSCiuc001qyf.4. human. [Q07444-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

NKG-2E

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L14542 mRNA. Translation: AAA16833.1.
AJ001685 Genomic DNA. Translation: CAA04923.1.
AF078550 mRNA. Translation: AAD46108.1.
AF350016 mRNA. Translation: AAK83803.1.
AF350017 mRNA. Translation: AAK83804.1.
AF461157 mRNA. Translation: AAL65232.1.
AC022075 Genomic DNA. No translation available.
AC068775 Genomic DNA. No translation available.
CCDSiCCDS31744.1. [Q07444-2]
CCDS41755.1. [Q07444-1]
PIRiI54524.
RefSeqiNP_002252.2. NM_002261.2. [Q07444-1]
NP_031359.2. NM_007333.2. [Q07444-2]
UniGeneiHs.654362.

3D structure databases

ProteinModelPortaliQ07444.
SMRiQ07444.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110022. 2 interactors.
IntActiQ07444. 1 interactor.
STRINGi9606.ENSP00000437563.

PTM databases

iPTMnetiQ07444.
PhosphoSitePlusiQ07444.

Polymorphism and mutation databases

BioMutaiKLRC3.
DMDMi296439288.

Proteomic databases

PaxDbiQ07444.
PRIDEiQ07444.

Protocols and materials databases

DNASUi3823.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000381903; ENSP00000371328; ENSG00000205810. [Q07444-2]
ENST00000396439; ENSP00000379716; ENSG00000205810. [Q07444-1]
GeneIDi3823.
KEGGihsa:3823.
UCSCiuc001qyf.4. human. [Q07444-1]

Organism-specific databases

CTDi3823.
GeneCardsiKLRC3.
HGNCiHGNC:6376. KLRC3.
HPAiHPA062570.
MIMi602892. gene.
neXtProtiNX_Q07444.
OpenTargetsiENSG00000205810.
PharmGKBiPA30165.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IWW4. Eukaryota.
ENOG410ZFTY. LUCA.
GeneTreeiENSGT00730000110282.
HOGENOMiHOG000220925.
HOVERGENiHBG077044.
InParanoidiQ07444.
KOiK06541.
OMAiRNDIMIA.
OrthoDBiEOG091G0I60.
PhylomeDBiQ07444.
TreeFamiTF336674.

Enzyme and pathway databases

BioCyciZFISH:G66-32452-MONOMER.

Miscellaneous databases

GenomeRNAii3823.
PROiQ07444.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000205810.
CleanExiHS_KLRC3.
GenevisibleiQ07444. HS.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin-like.
IPR016186. C-type_lectin-like/link.
IPR016187. CTDL_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNKG2E_HUMAN
AccessioniPrimary (citable) accession number: Q07444
Secondary accession number(s): Q8WXA4, Q96RL0, Q9UP04
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 18, 2010
Last modified: November 30, 2016
This is version 144 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.