Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q07326

- PIGF_HUMAN

UniProt

Q07326 - PIGF_HUMAN

Protein

Phosphatidylinositol-glycan biosynthesis class F protein

Gene

PIGF

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 1 (01 Feb 1995)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in GPI-anchor biosynthesis through the transfer of ethanolamine phosphate to the third mannose of GPI.By similarity

    Pathwayi

    GO - Molecular functioni

    1. ethanolaminephosphotransferase activity Source: ProtInc

    GO - Biological processi

    1. cellular protein metabolic process Source: Reactome
    2. C-terminal protein lipidation Source: Reactome
    3. GPI anchor biosynthetic process Source: UniProtKB
    4. post-translational protein modification Source: Reactome
    5. preassembly of GPI anchor in ER membrane Source: Reactome

    Keywords - Biological processi

    GPI-anchor biosynthesis

    Enzyme and pathway databases

    ReactomeiREACT_952. Synthesis of glycosylphosphatidylinositol (GPI).
    UniPathwayiUPA00196.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Phosphatidylinositol-glycan biosynthesis class F protein
    Short name:
    PIG-F
    Alternative name(s):
    GPI11 homolog
    Gene namesi
    Name:PIGF
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:8962. PIGF.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: UniProtKB
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33293.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 219219Phosphatidylinositol-glycan biosynthesis class F proteinPRO_0000191759Add
    BLAST

    Proteomic databases

    PRIDEiQ07326.

    Expressioni

    Gene expression databases

    ArrayExpressiQ07326.
    BgeeiQ07326.
    CleanExiHS_PIGF.
    GenevestigatoriQ07326.

    Organism-specific databases

    HPAiHPA051389.

    Interactioni

    Subunit structurei

    Forms a complex with PIGG and PIGO. PIGF is required to stabilize PIGG and PIGO.

    Protein-protein interaction databases

    BioGridi111299. 1 interaction.
    STRINGi9606.ENSP00000281382.

    Structurei

    3D structure databases

    ProteinModelPortaliQ07326.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei11 – 3121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei42 – 6221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei86 – 10621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei113 – 13321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei155 – 17521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei189 – 20921HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the PIGF family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG148715.
    HOGENOMiHOG000082526.
    HOVERGENiHBG031820.
    InParanoidiQ07326.
    KOiK05287.
    OMAiFSVYGTH.
    OrthoDBiEOG76HQ2X.
    PhylomeDBiQ07326.
    TreeFamiTF323878.

    Family and domain databases

    InterProiIPR009580. GPI_biosynthesis_protein_Pig-F.
    [Graphical view]
    PANTHERiPTHR15095. PTHR15095. 1 hit.
    PfamiPF06699. PIG-F. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q07326-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKDNDIKRLL YTHLLCIFSI ILSVFIPSLF LENFSILETH LTWLCICSGF    50
    VTAVNLVLYL VVKPNTSSKR SSLSHKVTGF LKCCIYFLMS CFSFHVIFVL 100
    YGAPLIELAL ETFLFAVILS TFTTVPCLCL LGPNLKAWLR VFSRNGVTSI 150
    WENSLQITTI SSFVGAWLGA LPIPLDWERP WQVWPISCTL GATFGYVAGL 200
    VISPLWIYWN RKQLTYKNN 219
    Length:219
    Mass (Da):24,890
    Last modified:February 1, 1995 - v1
    Checksum:i313F97A55B781EBF
    GO
    Isoform 2 (identifier: Q07326-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         183-219: VWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN → MTVERKRSTYRSLHVPCRGLGTVK

    Note: No experimental confirmation available.

    Show »
    Length:206
    Mass (Da):23,391
    Checksum:i2448DBF73784B1F4
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei183 – 21937VWPIS…TYKNN → MTVERKRSTYRSLHVPCRGL GTVK in isoform 2. 1 PublicationVSP_004361Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D13435 mRNA. Translation: BAA02697.1.
    BC021725 mRNA. Translation: AAH21725.1.
    BC029408 mRNA. Translation: AAH29408.1.
    CCDSiCCDS1827.1. [Q07326-1]
    CCDS1828.1. [Q07326-2]
    PIRiA46097.
    RefSeqiNP_002634.1. NM_002643.3. [Q07326-1]
    NP_775097.1. NM_173074.2. [Q07326-2]
    UniGeneiHs.468415.

    Genome annotation databases

    EnsembliENST00000281382; ENSP00000281382; ENSG00000151665. [Q07326-1]
    ENST00000306465; ENSP00000302663; ENSG00000151665. [Q07326-2]
    GeneIDi5281.
    KEGGihsa:5281.
    UCSCiuc002rvc.3. human. [Q07326-2]
    uc002rvd.3. human. [Q07326-1]

    Polymorphism databases

    DMDMi730326.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D13435 mRNA. Translation: BAA02697.1 .
    BC021725 mRNA. Translation: AAH21725.1 .
    BC029408 mRNA. Translation: AAH29408.1 .
    CCDSi CCDS1827.1. [Q07326-1 ]
    CCDS1828.1. [Q07326-2 ]
    PIRi A46097.
    RefSeqi NP_002634.1. NM_002643.3. [Q07326-1 ]
    NP_775097.1. NM_173074.2. [Q07326-2 ]
    UniGenei Hs.468415.

    3D structure databases

    ProteinModelPortali Q07326.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111299. 1 interaction.
    STRINGi 9606.ENSP00000281382.

    Polymorphism databases

    DMDMi 730326.

    Proteomic databases

    PRIDEi Q07326.

    Protocols and materials databases

    DNASUi 5281.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000281382 ; ENSP00000281382 ; ENSG00000151665 . [Q07326-1 ]
    ENST00000306465 ; ENSP00000302663 ; ENSG00000151665 . [Q07326-2 ]
    GeneIDi 5281.
    KEGGi hsa:5281.
    UCSCi uc002rvc.3. human. [Q07326-2 ]
    uc002rvd.3. human. [Q07326-1 ]

    Organism-specific databases

    CTDi 5281.
    GeneCardsi GC02M046808.
    HGNCi HGNC:8962. PIGF.
    HPAi HPA051389.
    MIMi 600153. gene.
    neXtProti NX_Q07326.
    PharmGKBi PA33293.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG148715.
    HOGENOMi HOG000082526.
    HOVERGENi HBG031820.
    InParanoidi Q07326.
    KOi K05287.
    OMAi FSVYGTH.
    OrthoDBi EOG76HQ2X.
    PhylomeDBi Q07326.
    TreeFami TF323878.

    Enzyme and pathway databases

    UniPathwayi UPA00196 .
    Reactomei REACT_952. Synthesis of glycosylphosphatidylinositol (GPI).

    Miscellaneous databases

    GeneWikii PIGF.
    GenomeRNAii 5281.
    NextBioi 20408.
    PROi Q07326.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q07326.
    Bgeei Q07326.
    CleanExi HS_PIGF.
    Genevestigatori Q07326.

    Family and domain databases

    InterProi IPR009580. GPI_biosynthesis_protein_Pig-F.
    [Graphical view ]
    PANTHERi PTHR15095. PTHR15095. 1 hit.
    Pfami PF06699. PIG-F. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning of a human gene, PIG-F, a component of glycosylphosphatidylinositol anchor biosynthesis, by a novel expression cloning strategy."
      Inoue N., Kinoshita T., Orii T., Takeda J.
      J. Biol. Chem. 268:6882-6885(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Testis.
    3. "GPI7 is the second partner of PIG-F and involved in modification of glycosylphosphatidylinositol."
      Shishioh N., Hong Y., Ohishi K., Ashida H., Maeda Y., Kinoshita T.
      J. Biol. Chem. 280:9728-9734(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH PIGG.
    4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiPIGF_HUMAN
    AccessioniPrimary (citable) accession number: Q07326
    Secondary accession number(s): Q8WW20
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1995
    Last sequence update: February 1, 1995
    Last modified: October 1, 2014
    This is version 120 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3