Q07326 (PIGF_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phosphatidylinositol-glycan biosynthesis class F protein Short name=PIG-F Alternative name(s): GPI11 homolog | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 219 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in GPI-anchor biosynthesis through the transfer of ethanolamine phosphate to the third mannose of GPI By similarity. |
| Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis. |
| Subunit structure | Forms a complex with PIGG and PIGO. PIGF is required to stabilize PIGG and PIGO. |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. |
| Sequence similarities | Belongs to the PIGF family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | GPI-anchor biosynthesis |
| Cellular component | Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | C-terminal protein lipidation Traceable author statement. Source: Reactome preassembly of GPI anchor in ER membraneTraceable author statement. Source: Reactome |
| Cellular_component | endoplasmic reticulum membrane Inferred from sequence or structural similarity. Source: UniProtKB integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | ethanolaminephosphotransferase activity Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q07326-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q07326-2) The sequence of this isoform differs from the canonical sequence as follows: 183-219: VWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN → MTVERKRSTYRSLHVPCRGLGTVK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 219 | 219 | Phosphatidylinositol-glycan biosynthesis class F protein | PRO_0000191759 | |||||
Regions | |||||||||
| Transmembrane | 11 – 31 | 21 | Helical; Potential | ||||||
| Transmembrane | 42 – 62 | 21 | Helical; Potential | ||||||
| Transmembrane | 86 – 106 | 21 | Helical; Potential | ||||||
| Transmembrane | 113 – 133 | 21 | Helical; Potential | ||||||
| Transmembrane | 155 – 175 | 21 | Helical; Potential | ||||||
| Transmembrane | 189 – 209 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 183 – 219 | 37 | VWPIS…TYKNN → MTVERKRSTYRSLHVPCRGL GTVK in isoform 2. | VSP_004361 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of a human gene, PIG-F, a component of glycosylphosphatidylinositol anchor biosynthesis, by a novel expression cloning strategy." Inoue N., Kinoshita T., Orii T., Takeda J. J. Biol. Chem. 268:6882-6885(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Testis. |
| [3] | "GPI7 is the second partner of PIG-F and involved in modification of glycosylphosphatidylinositol." Shishioh N., Hong Y., Ohishi K., Ashida H., Maeda Y., Kinoshita T. J. Biol. Chem. 280:9728-9734(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PIGG. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D13435 mRNA. Translation: BAA02697.1. BC021725 mRNA. Translation: AAH21725.1. BC029408 mRNA. Translation: AAH29408.1. |
| IPI | IPI00016536. IPI00220276. |
| PIR | A46097. |
| RefSeq | NP_002634.1. NM_002643.3. NP_775097.1. NM_173074.2. |
| UniGene | Hs.468415. |
3D structure databases | |
| ProteinModelPortal | Q07326. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000281382. |
Polymorphism databases | |
| DMDM | 730326. |
Proteomic databases | |
| PRIDE | Q07326. |
Protocols and materials databases | |
| DNASU | 5281. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000281382; ENSP00000281382; ENSG00000151665. ENST00000306465; ENSP00000302663; ENSG00000151665. |
| GeneID | 5281. |
| KEGG | hsa:5281. |
| UCSC | uc002rvc.3. human. uc002rvd.3. human. |
Organism-specific databases | |
| CTD | 5281. |
| GeneCards | GC02M046808. |
| HGNC | HGNC:8962. PIGF. |
| HPA | HPA051389. |
| MIM | 600153. gene. |
| neXtProt | NX_Q07326. |
| PharmGKB | PA33293. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG148715. |
| HOGENOM | HOG000082526. |
| HOVERGEN | HBG031820. |
| InParanoid | Q07326. |
| KO | K05287. |
| OMA | NGAMSIW. |
| OrthoDB | EOG4K0QPJ. |
| PhylomeDB | Q07326. |
Enzyme and pathway databases | |
| Reactome | REACT_17015. Metabolism of proteins. |
| UniPathway | UPA00196. |
Gene expression databases | |
| ArrayExpress | Q07326. |
| Bgee | Q07326. |
| CleanEx | HS_PIGF. |
| Genevestigator | Q07326. |
| GermOnline | ENSG00000151665. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR009580. GPI_biosynthesis_protein_Pig-F. [Graphical view] |
| PANTHER | PTHR15095. PTHR15095. 1 hit. |
| Pfam | PF06699. PIG-F. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 5281. |
| NextBio | 20408. |
| SOURCE | Search... |
Entry information
| Entry name | PIGF_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q07326 Secondary accession number(s): Q8WW20 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
