Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q07326

- PIGF_HUMAN

UniProt

Q07326 - PIGF_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Phosphatidylinositol-glycan biosynthesis class F protein

Gene

PIGF

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Involved in GPI-anchor biosynthesis through the transfer of ethanolamine phosphate to the third mannose of GPI.By similarity

Pathwayi

GO - Molecular functioni

  1. ethanolaminephosphotransferase activity Source: ProtInc

GO - Biological processi

  1. cellular protein metabolic process Source: Reactome
  2. C-terminal protein lipidation Source: Reactome
  3. GPI anchor biosynthetic process Source: UniProtKB
  4. post-translational protein modification Source: Reactome
  5. preassembly of GPI anchor in ER membrane Source: Reactome
Complete GO annotation...

Keywords - Biological processi

GPI-anchor biosynthesis

Enzyme and pathway databases

ReactomeiREACT_952. Synthesis of glycosylphosphatidylinositol (GPI).
UniPathwayiUPA00196.

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphatidylinositol-glycan biosynthesis class F protein
Short name:
PIG-F
Alternative name(s):
GPI11 homolog
Gene namesi
Name:PIGF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:8962. PIGF.

Subcellular locationi

GO - Cellular componenti

  1. endoplasmic reticulum membrane Source: UniProtKB
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33293.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 219219Phosphatidylinositol-glycan biosynthesis class F proteinPRO_0000191759Add
BLAST

Proteomic databases

PRIDEiQ07326.

Expressioni

Gene expression databases

BgeeiQ07326.
CleanExiHS_PIGF.
ExpressionAtlasiQ07326. baseline and differential.
GenevestigatoriQ07326.

Organism-specific databases

HPAiHPA051389.

Interactioni

Subunit structurei

Forms a complex with PIGG and PIGO. PIGF is required to stabilize PIGG and PIGO.

Protein-protein interaction databases

BioGridi111299. 1 interaction.
STRINGi9606.ENSP00000281382.

Structurei

3D structure databases

ProteinModelPortaliQ07326.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei11 – 3121HelicalSequence AnalysisAdd
BLAST
Transmembranei42 – 6221HelicalSequence AnalysisAdd
BLAST
Transmembranei86 – 10621HelicalSequence AnalysisAdd
BLAST
Transmembranei113 – 13321HelicalSequence AnalysisAdd
BLAST
Transmembranei155 – 17521HelicalSequence AnalysisAdd
BLAST
Transmembranei189 – 20921HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the PIGF family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG148715.
GeneTreeiENSGT00390000016617.
HOGENOMiHOG000082526.
HOVERGENiHBG031820.
InParanoidiQ07326.
KOiK05287.
OMAiFSVYGTH.
OrthoDBiEOG76HQ2X.
PhylomeDBiQ07326.
TreeFamiTF323878.

Family and domain databases

InterProiIPR009580. GPI_biosynthesis_protein_Pig-F.
[Graphical view]
PANTHERiPTHR15095. PTHR15095. 1 hit.
PfamiPF06699. PIG-F. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q07326-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKDNDIKRLL YTHLLCIFSI ILSVFIPSLF LENFSILETH LTWLCICSGF
60 70 80 90 100
VTAVNLVLYL VVKPNTSSKR SSLSHKVTGF LKCCIYFLMS CFSFHVIFVL
110 120 130 140 150
YGAPLIELAL ETFLFAVILS TFTTVPCLCL LGPNLKAWLR VFSRNGVTSI
160 170 180 190 200
WENSLQITTI SSFVGAWLGA LPIPLDWERP WQVWPISCTL GATFGYVAGL
210
VISPLWIYWN RKQLTYKNN
Length:219
Mass (Da):24,890
Last modified:February 1, 1995 - v1
Checksum:i313F97A55B781EBF
GO
Isoform 2 (identifier: Q07326-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-219: VWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN → MTVERKRSTYRSLHVPCRGLGTVK

Note: No experimental confirmation available.

Show »
Length:206
Mass (Da):23,391
Checksum:i2448DBF73784B1F4
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei183 – 21937VWPIS…TYKNN → MTVERKRSTYRSLHVPCRGL GTVK in isoform 2. 1 PublicationVSP_004361Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D13435 mRNA. Translation: BAA02697.1.
BC021725 mRNA. Translation: AAH21725.1.
BC029408 mRNA. Translation: AAH29408.1.
CCDSiCCDS1827.1. [Q07326-1]
CCDS1828.1. [Q07326-2]
PIRiA46097.
RefSeqiNP_002634.1. NM_002643.3. [Q07326-1]
NP_775097.1. NM_173074.2. [Q07326-2]
UniGeneiHs.468415.

Genome annotation databases

EnsembliENST00000281382; ENSP00000281382; ENSG00000151665. [Q07326-1]
ENST00000306465; ENSP00000302663; ENSG00000151665. [Q07326-2]
GeneIDi5281.
KEGGihsa:5281.
UCSCiuc002rvc.3. human. [Q07326-2]
uc002rvd.3. human. [Q07326-1]

Polymorphism databases

DMDMi730326.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D13435 mRNA. Translation: BAA02697.1 .
BC021725 mRNA. Translation: AAH21725.1 .
BC029408 mRNA. Translation: AAH29408.1 .
CCDSi CCDS1827.1. [Q07326-1 ]
CCDS1828.1. [Q07326-2 ]
PIRi A46097.
RefSeqi NP_002634.1. NM_002643.3. [Q07326-1 ]
NP_775097.1. NM_173074.2. [Q07326-2 ]
UniGenei Hs.468415.

3D structure databases

ProteinModelPortali Q07326.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111299. 1 interaction.
STRINGi 9606.ENSP00000281382.

Polymorphism databases

DMDMi 730326.

Proteomic databases

PRIDEi Q07326.

Protocols and materials databases

DNASUi 5281.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000281382 ; ENSP00000281382 ; ENSG00000151665 . [Q07326-1 ]
ENST00000306465 ; ENSP00000302663 ; ENSG00000151665 . [Q07326-2 ]
GeneIDi 5281.
KEGGi hsa:5281.
UCSCi uc002rvc.3. human. [Q07326-2 ]
uc002rvd.3. human. [Q07326-1 ]

Organism-specific databases

CTDi 5281.
GeneCardsi GC02M046808.
HGNCi HGNC:8962. PIGF.
HPAi HPA051389.
MIMi 600153. gene.
neXtProti NX_Q07326.
PharmGKBi PA33293.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG148715.
GeneTreei ENSGT00390000016617.
HOGENOMi HOG000082526.
HOVERGENi HBG031820.
InParanoidi Q07326.
KOi K05287.
OMAi FSVYGTH.
OrthoDBi EOG76HQ2X.
PhylomeDBi Q07326.
TreeFami TF323878.

Enzyme and pathway databases

UniPathwayi UPA00196 .
Reactomei REACT_952. Synthesis of glycosylphosphatidylinositol (GPI).

Miscellaneous databases

GeneWikii PIGF.
GenomeRNAii 5281.
NextBioi 20408.
PROi Q07326.
SOURCEi Search...

Gene expression databases

Bgeei Q07326.
CleanExi HS_PIGF.
ExpressionAtlasi Q07326. baseline and differential.
Genevestigatori Q07326.

Family and domain databases

InterProi IPR009580. GPI_biosynthesis_protein_Pig-F.
[Graphical view ]
PANTHERi PTHR15095. PTHR15095. 1 hit.
Pfami PF06699. PIG-F. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of a human gene, PIG-F, a component of glycosylphosphatidylinositol anchor biosynthesis, by a novel expression cloning strategy."
    Inoue N., Kinoshita T., Orii T., Takeda J.
    J. Biol. Chem. 268:6882-6885(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Testis.
  3. "GPI7 is the second partner of PIG-F and involved in modification of glycosylphosphatidylinositol."
    Shishioh N., Hong Y., Ohishi K., Ashida H., Maeda Y., Kinoshita T.
    J. Biol. Chem. 280:9728-9734(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PIGG.
  4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPIGF_HUMAN
AccessioniPrimary (citable) accession number: Q07326
Secondary accession number(s): Q8WW20
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: October 29, 2014
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3