Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q07326 (PIGF_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 116. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Phosphatidylinositol-glycan biosynthesis class F protein

Short name=PIG-F
Alternative name(s):
GPI11 homolog
Gene names
Name:PIGF
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length219 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Involved in GPI-anchor biosynthesis through the transfer of ethanolamine phosphate to the third mannose of GPI By similarity.

Pathway

Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.

Subunit structure

Forms a complex with PIGG and PIGO. PIGF is required to stabilize PIGG and PIGO.

Subcellular location

Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity.

Sequence similarities

Belongs to the PIGF family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q07326-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q07326-2)

The sequence of this isoform differs from the canonical sequence as follows:
     183-219: VWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN → MTVERKRSTYRSLHVPCRGLGTVK
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 219219Phosphatidylinositol-glycan biosynthesis class F protein
PRO_0000191759

Regions

Transmembrane11 – 3121Helical; Potential
Transmembrane42 – 6221Helical; Potential
Transmembrane86 – 10621Helical; Potential
Transmembrane113 – 13321Helical; Potential
Transmembrane155 – 17521Helical; Potential
Transmembrane189 – 20921Helical; Potential

Natural variations

Alternative sequence183 – 21937VWPIS…TYKNN → MTVERKRSTYRSLHVPCRGL GTVK in isoform 2.
VSP_004361

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 1, 1995. Version 1.
Checksum: 313F97A55B781EBF

FASTA21924,890
        10         20         30         40         50         60 
MKDNDIKRLL YTHLLCIFSI ILSVFIPSLF LENFSILETH LTWLCICSGF VTAVNLVLYL 

        70         80         90        100        110        120 
VVKPNTSSKR SSLSHKVTGF LKCCIYFLMS CFSFHVIFVL YGAPLIELAL ETFLFAVILS 

       130        140        150        160        170        180 
TFTTVPCLCL LGPNLKAWLR VFSRNGVTSI WENSLQITTI SSFVGAWLGA LPIPLDWERP 

       190        200        210 
WQVWPISCTL GATFGYVAGL VISPLWIYWN RKQLTYKNN 

« Hide

Isoform 2 [UniParc].

Checksum: 2448DBF73784B1F4
Show »

FASTA20623,391

References

« Hide 'large scale' references
[1]"Cloning of a human gene, PIG-F, a component of glycosylphosphatidylinositol anchor biosynthesis, by a novel expression cloning strategy."
Inoue N., Kinoshita T., Orii T., Takeda J.
J. Biol. Chem. 268:6882-6885(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Testis.
[3]"GPI7 is the second partner of PIG-F and involved in modification of glycosylphosphatidylinositol."
Shishioh N., Hong Y., Ohishi K., Ashida H., Maeda Y., Kinoshita T.
J. Biol. Chem. 280:9728-9734(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH PIGG.
[4]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D13435 mRNA. Translation: BAA02697.1.
BC021725 mRNA. Translation: AAH21725.1.
BC029408 mRNA. Translation: AAH29408.1.
PIRA46097.
RefSeqNP_002634.1. NM_002643.3.
NP_775097.1. NM_173074.2.
UniGeneHs.468415.

3D structure databases

ProteinModelPortalQ07326.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid111299. 1 interaction.
STRING9606.ENSP00000281382.

Polymorphism databases

DMDM730326.

Proteomic databases

PRIDEQ07326.

Protocols and materials databases

DNASU5281.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000281382; ENSP00000281382; ENSG00000151665. [Q07326-1]
ENST00000306465; ENSP00000302663; ENSG00000151665. [Q07326-2]
GeneID5281.
KEGGhsa:5281.
UCSCuc002rvc.3. human. [Q07326-2]
uc002rvd.3. human. [Q07326-1]

Organism-specific databases

CTD5281.
GeneCardsGC02M046808.
HGNCHGNC:8962. PIGF.
HPAHPA051389.
MIM600153. gene.
neXtProtNX_Q07326.
PharmGKBPA33293.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG148715.
HOGENOMHOG000082526.
HOVERGENHBG031820.
InParanoidQ07326.
KOK05287.
OMAFSVYGTH.
OrthoDBEOG76HQ2X.
PhylomeDBQ07326.
TreeFamTF323878.

Enzyme and pathway databases

ReactomeREACT_17015. Metabolism of proteins.
UniPathwayUPA00196.

Gene expression databases

ArrayExpressQ07326.
BgeeQ07326.
CleanExHS_PIGF.
GenevestigatorQ07326.

Family and domain databases

InterProIPR009580. GPI_biosynthesis_protein_Pig-F.
[Graphical view]
PANTHERPTHR15095. PTHR15095. 1 hit.
PfamPF06699. PIG-F. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiPIGF.
GenomeRNAi5281.
NextBio20408.
PROQ07326.
SOURCESearch...

Entry information

Entry namePIGF_HUMAN
AccessionPrimary (citable) accession number: Q07326
Secondary accession number(s): Q8WW20
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: April 16, 2014
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM