Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q07002

- CDK18_HUMAN

UniProt

Q07002 - CDK18_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cyclin-dependent kinase 18

Gene

CDK18

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play a role in signal transduction cascades in terminally differentiated cells.

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei171 – 1711ATPPROSITE-ProRule annotation
Active sitei263 – 2631Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi148 – 1569ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB-EC
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiQ07002.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 18 (EC:2.7.11.22)
Alternative name(s):
Cell division protein kinase 18
PCTAIRE-motif protein kinase 3
Serine/threonine-protein kinase PCTAIRE-3
Gene namesi
Name:CDK18
Synonyms:PCTAIRE3, PCTK3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:8751. CDK18.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33097.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 472472Cyclin-dependent kinase 18PRO_0000086490Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei12 – 121Phosphoserine1 Publication
Modified residuei72 – 721Phosphoserine2 Publications
Modified residuei87 – 871Phosphoserine3 Publications
Modified residuei96 – 961Phosphoserine1 Publication
Modified residuei115 – 1151Phosphoserine2 Publications
Modified residuei130 – 1301Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ07002.
PaxDbiQ07002.
PRIDEiQ07002.

PTM databases

PhosphoSiteiQ07002.

Expressioni

Tissue specificityi

Isoform 3 expression is limited to several subcortical nuclei of the basal gangli and the spinal cord. Isoform 2 is widely expressed.1 Publication

Gene expression databases

BgeeiQ07002.
CleanExiHS_PCTK3.
ExpressionAtlasiQ07002. baseline and differential.
GenevestigatoriQ07002.

Organism-specific databases

HPAiHPA045429.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
YWHAZP631042EBI-746238,EBI-347088

Protein-protein interaction databases

BioGridi111156. 36 interactions.
IntActiQ07002. 22 interactions.
MINTiMINT-3294654.
STRINGi9606.ENSP00000342589.

Structurei

3D structure databases

ProteinModelPortaliQ07002.
SMRiQ07002. Positions 89-449.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini142 – 423282Protein kinasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00600000083998.
HOGENOMiHOG000233024.
HOVERGENiHBG014652.
InParanoidiQ07002.
KOiK15596.
OMAiHDLIHTD.
OrthoDBiEOG7966H8.
PhylomeDBiQ07002.
TreeFamiTF106508.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q07002-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNKMKNFKRR FSLSVPRTET IEESLAEFTE QFNQLHNRRN ENLQLGPLGR
60 70 80 90 100
DPPQECSTFS PTDSGEEPGQ LSPGVQFQRR QNQRRFSMED VSKRLSLPMD
110 120 130 140 150
IRLPQEFLQK LQMESPDLPK PLSRMSRRAS LSDIGFGKLE TYVKLDKLGE
160 170 180 190 200
GTYATVFKGR SKLTENLVAL KEIRLEHEEG APCTAIREVS LLKNLKHANI
210 220 230 240 250
VTLHDLIHTD RSLTLVFEYL DSDLKQYLDH CGNLMSMHNV KIFMFQLLRG
260 270 280 290 300
LAYCHHRKIL HRDLKPQNLL INERGELKLA DFGLARAKSV PTKTYSNEVV
310 320 330 340 350
TLWYRPPDVL LGSTEYSTPI DMWGVGCIHY EMATGRPLFP GSTVKEELHL
360 370 380 390 400
IFRLLGTPTE ETWPGVTAFS EFRTYSFPCY LPQPLINHAP RLDTDGIHLL
410 420 430 440 450
SSLLLYESKS RMSAEAALSH SYFRSLGERV HQLEDTASIF SLKEIQLQKD
460 470
PGYRGLAFQQ PGRGKNRRQS IF
Length:472
Mass (Da):54,180
Last modified:October 17, 2006 - v3
Checksum:i5CD938D3565BD01A
GO
Isoform 2 (identifier: Q07002-2) [UniParc]FASTAAdd to Basket

Also known as: 3a

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MIM

Show »
Length:474
Mass (Da):54,424
Checksum:i43C83A573A595476
GO
Isoform 3 (identifier: Q07002-3) [UniParc]FASTAAdd to Basket

Also known as: 3b

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MIM
     89-89: E → EVRASGALPRQVAGCTHKGVHRRAAALQPDF

Show »
Length:504
Mass (Da):57,577
Checksum:i174DA12243EDE359
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti256 – 2561H → T in CAA47005. (PubMed:1639063)Curated
Sequence conflicti321 – 3211D → A in CAA47005. (PubMed:1639063)Curated
Sequence conflicti405 – 4051L → V in CAA47005. (PubMed:1639063)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti46 – 461G → S.1 Publication
VAR_047802
Natural varianti65 – 651G → R.1 Publication
VAR_047803
Natural varianti164 – 1641T → M.3 Publications
VAR_047804

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MIM in isoform 2 and isoform 3. 1 PublicationVSP_035888
Alternative sequencei89 – 891E → EVRASGALPRQVAGCTHKGV HRRAAALQPDF in isoform 3. 1 PublicationVSP_035889

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY353237 mRNA. Translation: AAR13065.1.
AY353238 mRNA. Translation: AAR13066.1.
BT007299 mRNA. Translation: AAP35963.1.
AL357131 Genomic DNA. Translation: CAH72012.1.
CH471067 Genomic DNA. Translation: EAW91559.1.
CH471067 Genomic DNA. Translation: EAW91560.1.
BC011526 mRNA. Translation: AAH11526.1.
X66362 mRNA. Translation: CAA47005.1.
CCDSiCCDS1454.1. [Q07002-3]
CCDS44300.1. [Q07002-2]
PIRiS32831.
RefSeqiNP_002587.2. NM_002596.3. [Q07002-2]
NP_997667.1. NM_212502.2. [Q07002-2]
NP_997668.1. NM_212503.2. [Q07002-3]
XP_006711428.1. XM_006711365.1. [Q07002-3]
UniGeneiHs.445402.

Genome annotation databases

EnsembliENST00000360066; ENSP00000353176; ENSG00000117266. [Q07002-2]
ENST00000429964; ENSP00000399082; ENSG00000117266. [Q07002-2]
ENST00000506784; ENSP00000423665; ENSG00000117266. [Q07002-3]
GeneIDi5129.
KEGGihsa:5129.
UCSCiuc001hcp.3. human. [Q07002-2]
uc001hcr.3. human. [Q07002-3]
uc001hcs.3. human. [Q07002-1]

Polymorphism databases

DMDMi116242704.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY353237 mRNA. Translation: AAR13065.1 .
AY353238 mRNA. Translation: AAR13066.1 .
BT007299 mRNA. Translation: AAP35963.1 .
AL357131 Genomic DNA. Translation: CAH72012.1 .
CH471067 Genomic DNA. Translation: EAW91559.1 .
CH471067 Genomic DNA. Translation: EAW91560.1 .
BC011526 mRNA. Translation: AAH11526.1 .
X66362 mRNA. Translation: CAA47005.1 .
CCDSi CCDS1454.1. [Q07002-3 ]
CCDS44300.1. [Q07002-2 ]
PIRi S32831.
RefSeqi NP_002587.2. NM_002596.3. [Q07002-2 ]
NP_997667.1. NM_212502.2. [Q07002-2 ]
NP_997668.1. NM_212503.2. [Q07002-3 ]
XP_006711428.1. XM_006711365.1. [Q07002-3 ]
UniGenei Hs.445402.

3D structure databases

ProteinModelPortali Q07002.
SMRi Q07002. Positions 89-449.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111156. 36 interactions.
IntActi Q07002. 22 interactions.
MINTi MINT-3294654.
STRINGi 9606.ENSP00000342589.

Chemistry

BindingDBi Q07002.
ChEMBLi CHEMBL5316.
GuidetoPHARMACOLOGYi 1971.

PTM databases

PhosphoSitei Q07002.

Polymorphism databases

DMDMi 116242704.

Proteomic databases

MaxQBi Q07002.
PaxDbi Q07002.
PRIDEi Q07002.

Protocols and materials databases

DNASUi 5129.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000360066 ; ENSP00000353176 ; ENSG00000117266 . [Q07002-2 ]
ENST00000429964 ; ENSP00000399082 ; ENSG00000117266 . [Q07002-2 ]
ENST00000506784 ; ENSP00000423665 ; ENSG00000117266 . [Q07002-3 ]
GeneIDi 5129.
KEGGi hsa:5129.
UCSCi uc001hcp.3. human. [Q07002-2 ]
uc001hcr.3. human. [Q07002-3 ]
uc001hcs.3. human. [Q07002-1 ]

Organism-specific databases

CTDi 5129.
GeneCardsi GC01P205474.
HGNCi HGNC:8751. CDK18.
HPAi HPA045429.
MIMi 169190. gene.
neXtProti NX_Q07002.
PharmGKBi PA33097.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
GeneTreei ENSGT00600000083998.
HOGENOMi HOG000233024.
HOVERGENi HBG014652.
InParanoidi Q07002.
KOi K15596.
OMAi HDLIHTD.
OrthoDBi EOG7966H8.
PhylomeDBi Q07002.
TreeFami TF106508.

Enzyme and pathway databases

SignaLinki Q07002.

Miscellaneous databases

ChiTaRSi CDK18. human.
GeneWikii PCTK3.
GenomeRNAii 5129.
NextBioi 19772.
PROi Q07002.
SOURCEi Search...

Gene expression databases

Bgeei Q07002.
CleanExi HS_PCTK3.
ExpressionAtlasi Q07002. baseline and differential.
Genevestigatori Q07002.

Family and domain databases

InterProi IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF00069. Pkinase. 1 hit.
[Graphical view ]
SMARTi SM00220. S_TKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and expression analysis of two novel PCTAIRE 3 transcripts from human brain."
    Herskovits A.Z., Davies P.
    Gene 328:59-67(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY.
    Tissue: Hippocampus.
  2. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-164.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-164.
    Tissue: Colon.
  6. "A family of human cdc2-related protein kinases."
    Meyerson M., Enders G.H., Wu C.-L., Su L.-K., Gorka C., Nelson C., Harlow E., Tsai L.-H.
    EMBO J. 11:2909-2917(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 93-472.
  7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-72; SER-87 AND SER-115, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12; SER-87 AND SER-130, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-72; SER-87; SER-96 AND SER-115, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-46; ARG-65 AND MET-164.

Entry informationi

Entry nameiCDK18_HUMAN
AccessioniPrimary (citable) accession number: Q07002
Secondary accession number(s): Q5VXQ2
, Q6V3A2, Q6V3A3, Q96F90
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: October 17, 2006
Last modified: October 29, 2014
This is version 147 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3