Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q07002

- CDK18_HUMAN

UniProt

Q07002 - CDK18_HUMAN

Protein

Cyclin-dependent kinase 18

Gene

CDK18

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 146 (01 Oct 2014)
      Sequence version 3 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in signal transduction cascades in terminally differentiated cells.

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei171 – 1711ATPPROSITE-ProRule annotation
    Active sitei263 – 2631Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi148 – 1569ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB-EC
    3. protein binding Source: IntAct

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    SignaLinkiQ07002.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cyclin-dependent kinase 18 (EC:2.7.11.22)
    Alternative name(s):
    Cell division protein kinase 18
    PCTAIRE-motif protein kinase 3
    Serine/threonine-protein kinase PCTAIRE-3
    Gene namesi
    Name:CDK18
    Synonyms:PCTAIRE3, PCTK3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:8751. CDK18.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33097.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 472472Cyclin-dependent kinase 18PRO_0000086490Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei12 – 121Phosphoserine1 Publication
    Modified residuei72 – 721Phosphoserine2 Publications
    Modified residuei87 – 871Phosphoserine3 Publications
    Modified residuei96 – 961Phosphoserine1 Publication
    Modified residuei115 – 1151Phosphoserine2 Publications
    Modified residuei130 – 1301Phosphoserine2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ07002.
    PaxDbiQ07002.
    PRIDEiQ07002.

    PTM databases

    PhosphoSiteiQ07002.

    Expressioni

    Tissue specificityi

    Isoform 3 expression is limited to several subcortical nuclei of the basal gangli and the spinal cord. Isoform 2 is widely expressed.1 Publication

    Gene expression databases

    ArrayExpressiQ07002.
    BgeeiQ07002.
    CleanExiHS_PCTK3.
    GenevestigatoriQ07002.

    Organism-specific databases

    HPAiHPA045429.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    YWHAZP631042EBI-746238,EBI-347088

    Protein-protein interaction databases

    BioGridi111156. 23 interactions.
    IntActiQ07002. 22 interactions.
    MINTiMINT-3294654.
    STRINGi9606.ENSP00000342589.

    Structurei

    3D structure databases

    ProteinModelPortaliQ07002.
    SMRiQ07002. Positions 89-449.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini142 – 423282Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    HOGENOMiHOG000233024.
    HOVERGENiHBG014652.
    KOiK15596.
    OMAiHDLIHTD.
    OrthoDBiEOG7966H8.
    PhylomeDBiQ07002.
    TreeFamiTF106508.

    Family and domain databases

    InterProiIPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view]
    PfamiPF00069. Pkinase. 1 hit.
    [Graphical view]
    SMARTiSM00220. S_TKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q07002-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNKMKNFKRR FSLSVPRTET IEESLAEFTE QFNQLHNRRN ENLQLGPLGR    50
    DPPQECSTFS PTDSGEEPGQ LSPGVQFQRR QNQRRFSMED VSKRLSLPMD 100
    IRLPQEFLQK LQMESPDLPK PLSRMSRRAS LSDIGFGKLE TYVKLDKLGE 150
    GTYATVFKGR SKLTENLVAL KEIRLEHEEG APCTAIREVS LLKNLKHANI 200
    VTLHDLIHTD RSLTLVFEYL DSDLKQYLDH CGNLMSMHNV KIFMFQLLRG 250
    LAYCHHRKIL HRDLKPQNLL INERGELKLA DFGLARAKSV PTKTYSNEVV 300
    TLWYRPPDVL LGSTEYSTPI DMWGVGCIHY EMATGRPLFP GSTVKEELHL 350
    IFRLLGTPTE ETWPGVTAFS EFRTYSFPCY LPQPLINHAP RLDTDGIHLL 400
    SSLLLYESKS RMSAEAALSH SYFRSLGERV HQLEDTASIF SLKEIQLQKD 450
    PGYRGLAFQQ PGRGKNRRQS IF 472
    Length:472
    Mass (Da):54,180
    Last modified:October 17, 2006 - v3
    Checksum:i5CD938D3565BD01A
    GO
    Isoform 2 (identifier: Q07002-2) [UniParc]FASTAAdd to Basket

    Also known as: 3a

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MIM

    Show »
    Length:474
    Mass (Da):54,424
    Checksum:i43C83A573A595476
    GO
    Isoform 3 (identifier: Q07002-3) [UniParc]FASTAAdd to Basket

    Also known as: 3b

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MIM
         89-89: E → EVRASGALPRQVAGCTHKGVHRRAAALQPDF

    Show »
    Length:504
    Mass (Da):57,577
    Checksum:i174DA12243EDE359
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti256 – 2561H → T in CAA47005. (PubMed:1639063)Curated
    Sequence conflicti321 – 3211D → A in CAA47005. (PubMed:1639063)Curated
    Sequence conflicti405 – 4051L → V in CAA47005. (PubMed:1639063)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti46 – 461G → S.1 Publication
    VAR_047802
    Natural varianti65 – 651G → R.1 Publication
    VAR_047803
    Natural varianti164 – 1641T → M.3 Publications
    VAR_047804

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MIM in isoform 2 and isoform 3. 1 PublicationVSP_035888
    Alternative sequencei89 – 891E → EVRASGALPRQVAGCTHKGV HRRAAALQPDF in isoform 3. 1 PublicationVSP_035889

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY353237 mRNA. Translation: AAR13065.1.
    AY353238 mRNA. Translation: AAR13066.1.
    BT007299 mRNA. Translation: AAP35963.1.
    AL357131 Genomic DNA. Translation: CAH72012.1.
    CH471067 Genomic DNA. Translation: EAW91559.1.
    CH471067 Genomic DNA. Translation: EAW91560.1.
    BC011526 mRNA. Translation: AAH11526.1.
    X66362 mRNA. Translation: CAA47005.1.
    CCDSiCCDS1454.1. [Q07002-3]
    CCDS44300.1. [Q07002-2]
    PIRiS32831.
    RefSeqiNP_002587.2. NM_002596.3. [Q07002-2]
    NP_997667.1. NM_212502.2. [Q07002-2]
    NP_997668.1. NM_212503.2. [Q07002-3]
    XP_006711428.1. XM_006711365.1. [Q07002-3]
    UniGeneiHs.445402.

    Genome annotation databases

    EnsembliENST00000360066; ENSP00000353176; ENSG00000117266. [Q07002-2]
    ENST00000429964; ENSP00000399082; ENSG00000117266. [Q07002-2]
    ENST00000506784; ENSP00000423665; ENSG00000117266. [Q07002-3]
    GeneIDi5129.
    KEGGihsa:5129.
    UCSCiuc001hcp.3. human. [Q07002-2]
    uc001hcr.3. human. [Q07002-3]
    uc001hcs.3. human. [Q07002-1]

    Polymorphism databases

    DMDMi116242704.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY353237 mRNA. Translation: AAR13065.1 .
    AY353238 mRNA. Translation: AAR13066.1 .
    BT007299 mRNA. Translation: AAP35963.1 .
    AL357131 Genomic DNA. Translation: CAH72012.1 .
    CH471067 Genomic DNA. Translation: EAW91559.1 .
    CH471067 Genomic DNA. Translation: EAW91560.1 .
    BC011526 mRNA. Translation: AAH11526.1 .
    X66362 mRNA. Translation: CAA47005.1 .
    CCDSi CCDS1454.1. [Q07002-3 ]
    CCDS44300.1. [Q07002-2 ]
    PIRi S32831.
    RefSeqi NP_002587.2. NM_002596.3. [Q07002-2 ]
    NP_997667.1. NM_212502.2. [Q07002-2 ]
    NP_997668.1. NM_212503.2. [Q07002-3 ]
    XP_006711428.1. XM_006711365.1. [Q07002-3 ]
    UniGenei Hs.445402.

    3D structure databases

    ProteinModelPortali Q07002.
    SMRi Q07002. Positions 89-449.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111156. 23 interactions.
    IntActi Q07002. 22 interactions.
    MINTi MINT-3294654.
    STRINGi 9606.ENSP00000342589.

    Chemistry

    BindingDBi Q07002.
    ChEMBLi CHEMBL5316.
    GuidetoPHARMACOLOGYi 1971.

    PTM databases

    PhosphoSitei Q07002.

    Polymorphism databases

    DMDMi 116242704.

    Proteomic databases

    MaxQBi Q07002.
    PaxDbi Q07002.
    PRIDEi Q07002.

    Protocols and materials databases

    DNASUi 5129.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000360066 ; ENSP00000353176 ; ENSG00000117266 . [Q07002-2 ]
    ENST00000429964 ; ENSP00000399082 ; ENSG00000117266 . [Q07002-2 ]
    ENST00000506784 ; ENSP00000423665 ; ENSG00000117266 . [Q07002-3 ]
    GeneIDi 5129.
    KEGGi hsa:5129.
    UCSCi uc001hcp.3. human. [Q07002-2 ]
    uc001hcr.3. human. [Q07002-3 ]
    uc001hcs.3. human. [Q07002-1 ]

    Organism-specific databases

    CTDi 5129.
    GeneCardsi GC01P205474.
    HGNCi HGNC:8751. CDK18.
    HPAi HPA045429.
    MIMi 169190. gene.
    neXtProti NX_Q07002.
    PharmGKBi PA33097.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOGENOMi HOG000233024.
    HOVERGENi HBG014652.
    KOi K15596.
    OMAi HDLIHTD.
    OrthoDBi EOG7966H8.
    PhylomeDBi Q07002.
    TreeFami TF106508.

    Enzyme and pathway databases

    SignaLinki Q07002.

    Miscellaneous databases

    ChiTaRSi CDK18. human.
    GeneWikii PCTK3.
    GenomeRNAii 5129.
    NextBioi 19772.
    PROi Q07002.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q07002.
    Bgeei Q07002.
    CleanExi HS_PCTK3.
    Genevestigatori Q07002.

    Family and domain databases

    InterProi IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view ]
    Pfami PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SMARTi SM00220. S_TKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and expression analysis of two novel PCTAIRE 3 transcripts from human brain."
      Herskovits A.Z., Davies P.
      Gene 328:59-67(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY.
      Tissue: Hippocampus.
    2. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-164.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-164.
      Tissue: Colon.
    6. "A family of human cdc2-related protein kinases."
      Meyerson M., Enders G.H., Wu C.-L., Su L.-K., Gorka C., Nelson C., Harlow E., Tsai L.-H.
      EMBO J. 11:2909-2917(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 93-472.
    7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-72; SER-87 AND SER-115, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12; SER-87 AND SER-130, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-72; SER-87; SER-96 AND SER-115, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-46; ARG-65 AND MET-164.

    Entry informationi

    Entry nameiCDK18_HUMAN
    AccessioniPrimary (citable) accession number: Q07002
    Secondary accession number(s): Q5VXQ2
    , Q6V3A2, Q6V3A3, Q96F90
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 1994
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 146 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3