Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q07002 (CDK18_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 145. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cyclin-dependent kinase 18

EC=2.7.11.22
Alternative name(s):
Cell division protein kinase 18
PCTAIRE-motif protein kinase 3
Serine/threonine-protein kinase PCTAIRE-3
Gene names
Name:CDK18
Synonyms:PCTAIRE3, PCTK3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length472 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role in signal transduction cascades in terminally differentiated cells.

Catalytic activity

ATP + a protein = ADP + a phosphoprotein.

Tissue specificity

Isoform 3 expression is limited to several subcortical nuclei of the basal gangli and the spinal cord. Isoform 2 is widely expressed. Ref.1

Sequence similarities

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

Contains 1 protein kinase domain.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

YWHAZP631042EBI-746238,EBI-347088

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q07002-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q07002-2)

Also known as: 3a;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MIM
Isoform 3 (identifier: Q07002-3)

Also known as: 3b;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MIM
     89-89: E → EVRASGALPRQVAGCTHKGVHRRAAALQPDF

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 472472Cyclin-dependent kinase 18
PRO_0000086490

Regions

Domain142 – 423282Protein kinase
Nucleotide binding148 – 1569ATP By similarity

Sites

Active site2631Proton acceptor By similarity
Binding site1711ATP By similarity

Amino acid modifications

Modified residue121Phosphoserine Ref.8
Modified residue721Phosphoserine Ref.7 Ref.9
Modified residue871Phosphoserine Ref.7 Ref.8 Ref.9
Modified residue961Phosphoserine Ref.9
Modified residue1151Phosphoserine Ref.7 Ref.9
Modified residue1301Phosphoserine Ref.8 Ref.10

Natural variations

Alternative sequence11M → MIM in isoform 2 and isoform 3.
VSP_035888
Alternative sequence891E → EVRASGALPRQVAGCTHKGV HRRAAALQPDF in isoform 3.
VSP_035889
Natural variant461G → S. Ref.11
VAR_047802
Natural variant651G → R. Ref.11
VAR_047803
Natural variant1641T → M. Ref.2 Ref.5 Ref.11
VAR_047804

Experimental info

Sequence conflict2561H → T in CAA47005. Ref.6
Sequence conflict3211D → A in CAA47005. Ref.6
Sequence conflict4051L → V in CAA47005. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 17, 2006. Version 3.
Checksum: 5CD938D3565BD01A

FASTA47254,180
        10         20         30         40         50         60 
MNKMKNFKRR FSLSVPRTET IEESLAEFTE QFNQLHNRRN ENLQLGPLGR DPPQECSTFS 

        70         80         90        100        110        120 
PTDSGEEPGQ LSPGVQFQRR QNQRRFSMED VSKRLSLPMD IRLPQEFLQK LQMESPDLPK 

       130        140        150        160        170        180 
PLSRMSRRAS LSDIGFGKLE TYVKLDKLGE GTYATVFKGR SKLTENLVAL KEIRLEHEEG 

       190        200        210        220        230        240 
APCTAIREVS LLKNLKHANI VTLHDLIHTD RSLTLVFEYL DSDLKQYLDH CGNLMSMHNV 

       250        260        270        280        290        300 
KIFMFQLLRG LAYCHHRKIL HRDLKPQNLL INERGELKLA DFGLARAKSV PTKTYSNEVV 

       310        320        330        340        350        360 
TLWYRPPDVL LGSTEYSTPI DMWGVGCIHY EMATGRPLFP GSTVKEELHL IFRLLGTPTE 

       370        380        390        400        410        420 
ETWPGVTAFS EFRTYSFPCY LPQPLINHAP RLDTDGIHLL SSLLLYESKS RMSAEAALSH 

       430        440        450        460        470 
SYFRSLGERV HQLEDTASIF SLKEIQLQKD PGYRGLAFQQ PGRGKNRRQS IF 

« Hide

Isoform 2 (3a) [UniParc].

Checksum: 43C83A573A595476
Show »

FASTA47454,424
Isoform 3 (3b) [UniParc].

Checksum: 174DA12243EDE359
Show »

FASTA50457,577

References

« Hide 'large scale' references
[1]"Cloning and expression analysis of two novel PCTAIRE 3 transcripts from human brain."
Herskovits A.Z., Davies P.
Gene 328:59-67(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY.
Tissue: Hippocampus.
[2]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-164.
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-164.
Tissue: Colon.
[6]"A family of human cdc2-related protein kinases."
Meyerson M., Enders G.H., Wu C.-L., Su L.-K., Gorka C., Nelson C., Harlow E., Tsai L.-H.
EMBO J. 11:2909-2917(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 93-472.
[7]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-72; SER-87 AND SER-115, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12; SER-87 AND SER-130, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"Large-scale proteomics analysis of the human kinome."
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H.
Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-72; SER-87; SER-96 AND SER-115, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[10]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"Patterns of somatic mutation in human cancer genomes."
Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. expand/collapse author list , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-46; ARG-65 AND MET-164.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY353237 mRNA. Translation: AAR13065.1.
AY353238 mRNA. Translation: AAR13066.1.
BT007299 mRNA. Translation: AAP35963.1.
AL357131 Genomic DNA. Translation: CAH72012.1.
CH471067 Genomic DNA. Translation: EAW91559.1.
CH471067 Genomic DNA. Translation: EAW91560.1.
BC011526 mRNA. Translation: AAH11526.1.
X66362 mRNA. Translation: CAA47005.1.
CCDSCCDS1454.1. [Q07002-3]
CCDS44300.1. [Q07002-2]
PIRS32831.
RefSeqNP_002587.2. NM_002596.3. [Q07002-2]
NP_997667.1. NM_212502.2. [Q07002-2]
NP_997668.1. NM_212503.2. [Q07002-3]
XP_006711428.1. XM_006711365.1. [Q07002-3]
UniGeneHs.445402.

3D structure databases

ProteinModelPortalQ07002.
SMRQ07002. Positions 89-449.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid111156. 23 interactions.
IntActQ07002. 22 interactions.
MINTMINT-3294654.
STRING9606.ENSP00000342589.

Chemistry

BindingDBQ07002.
ChEMBLCHEMBL5316.
GuidetoPHARMACOLOGY1971.

PTM databases

PhosphoSiteQ07002.

Polymorphism databases

DMDM116242704.

Proteomic databases

MaxQBQ07002.
PaxDbQ07002.
PRIDEQ07002.

Protocols and materials databases

DNASU5129.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000360066; ENSP00000353176; ENSG00000117266. [Q07002-2]
ENST00000429964; ENSP00000399082; ENSG00000117266. [Q07002-2]
ENST00000506784; ENSP00000423665; ENSG00000117266. [Q07002-3]
GeneID5129.
KEGGhsa:5129.
UCSCuc001hcp.3. human. [Q07002-2]
uc001hcr.3. human. [Q07002-3]
uc001hcs.3. human. [Q07002-1]

Organism-specific databases

CTD5129.
GeneCardsGC01P205474.
HGNCHGNC:8751. CDK18.
HPAHPA045429.
MIM169190. gene.
neXtProtNX_Q07002.
PharmGKBPA33097.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0515.
HOGENOMHOG000233024.
HOVERGENHBG014652.
KOK15596.
OMAHDLIHTD.
OrthoDBEOG7966H8.
PhylomeDBQ07002.
TreeFamTF106508.

Enzyme and pathway databases

SignaLinkQ07002.

Gene expression databases

ArrayExpressQ07002.
BgeeQ07002.
CleanExHS_PCTK3.
GenevestigatorQ07002.

Family and domain databases

InterProIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMSSF56112. SSF56112. 1 hit.
PROSITEPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCDK18. human.
GeneWikiPCTK3.
GenomeRNAi5129.
NextBio19772.
PROQ07002.
SOURCESearch...

Entry information

Entry nameCDK18_HUMAN
AccessionPrimary (citable) accession number: Q07002
Secondary accession number(s): Q5VXQ2 expand/collapse secondary AC list , Q6V3A2, Q6V3A3, Q96F90
Entry history
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: October 17, 2006
Last modified: July 9, 2014
This is version 145 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM