Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-dependent kinase 18

Gene

CDK18

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in signal transduction cascades in terminally differentiated cells.

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei171ATPPROSITE-ProRule annotation1
Active sitei263Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi148 – 156ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.22. 2681.
SignaLinkiQ07002.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 18 (EC:2.7.11.22)
Alternative name(s):
Cell division protein kinase 18
PCTAIRE-motif protein kinase 3
Serine/threonine-protein kinase PCTAIRE-3
Gene namesi
Name:CDK18
Synonyms:PCTAIRE3, PCTK3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000117266.15.
HGNCiHGNC:8751. CDK18.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi5129.
OpenTargetsiENSG00000117266.
PharmGKBiPA33097.

Chemistry databases

ChEMBLiCHEMBL5316.
GuidetoPHARMACOLOGYi1971.

Polymorphism and mutation databases

DMDMi116242704.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000864901 – 472Cyclin-dependent kinase 18Add BLAST472

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei12PhosphoserineCombined sources1
Modified residuei72PhosphoserineCombined sources1
Modified residuei87PhosphoserineCombined sources1
Modified residuei96PhosphoserineCombined sources1
Modified residuei115PhosphoserineCombined sources1
Modified residuei130PhosphoserineCombined sources1
Modified residuei438PhosphoserineBy similarity1
Modified residuei441PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ07002.
MaxQBiQ07002.
PeptideAtlasiQ07002.
PRIDEiQ07002.

PTM databases

iPTMnetiQ07002.
PhosphoSitePlusiQ07002.

Expressioni

Tissue specificityi

Isoform 3 expression is limited to several subcortical nuclei of the basal gangli and the spinal cord. Isoform 2 is widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000117266.
CleanExiHS_PCTK3.
ExpressionAtlasiQ07002. baseline and differential.
GenevisibleiQ07002. HS.

Organism-specific databases

HPAiHPA045429.

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi111156. 63 interactors.
IntActiQ07002. 76 interactors.
MINTiMINT-3294654.

Chemistry databases

BindingDBiQ07002.

Structurei

3D structure databases

ProteinModelPortaliQ07002.
SMRiQ07002.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini142 – 423Protein kinasePROSITE-ProRule annotationAdd BLAST282

Sequence similaritiesi

Phylogenomic databases

GeneTreeiENSGT00900000140869.
HOGENOMiHOG000233024.
HOVERGENiHBG014652.
InParanoidiQ07002.
KOiK15596.
OMAiQYLDNCG.
OrthoDBiEOG091G0CH0.
PhylomeDBiQ07002.
TreeFamiTF106508.

Family and domain databases

InterProiView protein in InterPro
IPR011009. Kinase-like_dom_sf.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
PfamiView protein in Pfam
PF00069. Pkinase. 1 hit.
SMARTiView protein in SMART
SM00220. S_TKc. 1 hit.
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiView protein in PROSITE
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q07002-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNKMKNFKRR FSLSVPRTET IEESLAEFTE QFNQLHNRRN ENLQLGPLGR
60 70 80 90 100
DPPQECSTFS PTDSGEEPGQ LSPGVQFQRR QNQRRFSMED VSKRLSLPMD
110 120 130 140 150
IRLPQEFLQK LQMESPDLPK PLSRMSRRAS LSDIGFGKLE TYVKLDKLGE
160 170 180 190 200
GTYATVFKGR SKLTENLVAL KEIRLEHEEG APCTAIREVS LLKNLKHANI
210 220 230 240 250
VTLHDLIHTD RSLTLVFEYL DSDLKQYLDH CGNLMSMHNV KIFMFQLLRG
260 270 280 290 300
LAYCHHRKIL HRDLKPQNLL INERGELKLA DFGLARAKSV PTKTYSNEVV
310 320 330 340 350
TLWYRPPDVL LGSTEYSTPI DMWGVGCIHY EMATGRPLFP GSTVKEELHL
360 370 380 390 400
IFRLLGTPTE ETWPGVTAFS EFRTYSFPCY LPQPLINHAP RLDTDGIHLL
410 420 430 440 450
SSLLLYESKS RMSAEAALSH SYFRSLGERV HQLEDTASIF SLKEIQLQKD
460 470
PGYRGLAFQQ PGRGKNRRQS IF
Length:472
Mass (Da):54,180
Last modified:October 17, 2006 - v3
Checksum:i5CD938D3565BD01A
GO
Isoform 2 (identifier: Q07002-2) [UniParc]FASTAAdd to basket
Also known as: 3a

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MIM

Show »
Length:474
Mass (Da):54,424
Checksum:i43C83A573A595476
GO
Isoform 3 (identifier: Q07002-3) [UniParc]FASTAAdd to basket
Also known as: 3b

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MIM
     89-89: E → EVRASGALPRQVAGCTHKGVHRRAAALQPDF

Show »
Length:504
Mass (Da):57,577
Checksum:i174DA12243EDE359
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti256H → T in CAA47005 (PubMed:1639063).Curated1
Sequence conflicti321D → A in CAA47005 (PubMed:1639063).Curated1
Sequence conflicti405L → V in CAA47005 (PubMed:1639063).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04780246G → S1 Publication1
Natural variantiVAR_04780365G → R1 Publication1
Natural variantiVAR_047804164T → M3 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0358881M → MIM in isoform 2 and isoform 3. 1 Publication1
Alternative sequenceiVSP_03588989E → EVRASGALPRQVAGCTHKGV HRRAAALQPDF in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY353237 mRNA. Translation: AAR13065.1.
AY353238 mRNA. Translation: AAR13066.1.
BT007299 mRNA. Translation: AAP35963.1.
AL357131 Genomic DNA. Translation: CAH72012.1.
CH471067 Genomic DNA. Translation: EAW91559.1.
CH471067 Genomic DNA. Translation: EAW91560.1.
BC011526 mRNA. Translation: AAH11526.1.
X66362 mRNA. Translation: CAA47005.1.
CCDSiCCDS1454.1. [Q07002-3]
CCDS44300.1. [Q07002-2]
PIRiS32831.
RefSeqiNP_002587.2. NM_002596.3. [Q07002-2]
NP_997667.1. NM_212502.2. [Q07002-2]
NP_997668.1. NM_212503.2. [Q07002-3]
UniGeneiHs.445402.

Genome annotation databases

EnsembliENST00000360066; ENSP00000353176; ENSG00000117266. [Q07002-2]
ENST00000429964; ENSP00000399082; ENSG00000117266. [Q07002-2]
ENST00000506784; ENSP00000423665; ENSG00000117266. [Q07002-3]
GeneIDi5129.
KEGGihsa:5129.
UCSCiuc001hcp.4. human. [Q07002-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCDK18_HUMAN
AccessioniPrimary (citable) accession number: Q07002
Secondary accession number(s): Q5VXQ2
, Q6V3A2, Q6V3A3, Q96F90
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: October 17, 2006
Last modified: November 22, 2017
This is version 179 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families