Q07002 (CDK18_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cyclin-dependent kinase 18 EC=2.7.11.22 Alternative name(s): Cell division protein kinase 18 PCTAIRE-motif protein kinase 3 Serine/threonine-protein kinase PCTAIRE-3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 472 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in signal transduction cascades in terminally differentiated cells. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Tissue specificity | Isoform 3 expression is limited to several subcortical nuclei of the basal gangli and the spinal cord. Isoform 2 is widely expressed. Ref.1 |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Molecular function | ATP binding Non-traceable author statement. Source: UniProtKB cyclin-dependent protein kinase activityInferred from electronic annotation. Source: EC signal transducer activityNon-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q07002-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q07002-2) Also known as: 3a; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MIM | ||||||
| Isoform 3 (identifier: Q07002-3) Also known as: 3b; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MIM 89-89: E → EVRASGALPRQVAGCTHKGVHRRAAALQPDF | ||||||
| Note: Phosphorylated on Ser-89. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 472 | 472 | Cyclin-dependent kinase 18 | PRO_0000086490 | |||||
Regions | |||||||||
| Domain | 142 – 423 | 282 | Protein kinase | ||||||
| Nucleotide binding | 148 – 156 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 263 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 171 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 12 | 1 | Phosphoserine Ref.8 Ref.9 Ref.10 Ref.11 | ||||||
| Modified residue | 14 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 57 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 72 | 1 | Phosphoserine Ref.9 Ref.11 | ||||||
| Modified residue | 87 | 1 | Phosphoserine Ref.8 Ref.9 Ref.10 Ref.11 | ||||||
| Modified residue | 96 | 1 | Phosphoserine Ref.9 Ref.11 | ||||||
| Modified residue | 115 | 1 | Phosphoserine Ref.9 Ref.11 | ||||||
| Modified residue | 130 | 1 | Phosphoserine Ref.8 Ref.9 Ref.10 Ref.11 | ||||||
| Modified residue | 132 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 141 | 1 | Phosphothreonine Ref.11 | ||||||
| Modified residue | 155 | 1 | Phosphothreonine Ref.9 | ||||||
| Modified residue | 470 | 1 | Phosphoserine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MIM in isoform 2 and isoform 3. | VSP_035888 | |||||
| Alternative sequence | 89 | 1 | E → EVRASGALPRQVAGCTHKGV HRRAAALQPDF in isoform 3. | VSP_035889 | |||||
| Natural variant | 46 | 1 | G → S. Ref.12 | VAR_047802 | |||||
| Natural variant | 65 | 1 | G → R. Ref.12 | VAR_047803 | |||||
| Natural variant | 164 | 1 | T → M. Ref.2 Ref.5 Ref.12 | VAR_047804 | |||||
Experimental info | |||||||||
| Sequence conflict | 256 | 1 | H → T in CAA47005. Ref.6 | ||||||
| Sequence conflict | 321 | 1 | D → A in CAA47005. Ref.6 | ||||||
| Sequence conflict | 405 | 1 | L → V in CAA47005. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression analysis of two novel PCTAIRE 3 transcripts from human brain." Herskovits A.Z., Davies P. Gene 328:59-67(2004) [PubMed: 15019984] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY. Tissue: Hippocampus. |
| [2] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-164. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-164. Tissue: Colon. |
| [6] | "A family of human cdc2-related protein kinases." Meyerson M., Enders G.H., Wu C.-L., Su L.-K., Gorka C., Nelson C., Harlow E., Tsai L.-H. EMBO J. 11:2909-2917(1992) [PubMed: 1639063] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 93-472. |
| [7] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-132, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." Wissing J., Jaensch L., Nimtz M., Dieterich G., Hornberger R., Keri G., Wehland J., Daub H. Mol. Cell. Proteomics 6:537-547(2007) [PubMed: 17192257] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12; SER-87 AND SER-130, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [9] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12; SER-72; SER-87; SER-96; SER-115; SER-130; THR-155 AND SER-470, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12; SER-87 AND SER-130, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12; SER-14; SER-57; SER-72; SER-87; SER-96; SER-115; SER-130 AND THR-141, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-89 (ISOFORM 3), MASS SPECTROMETRY. |
| [12] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-46; ARG-65 AND MET-164. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY353237 mRNA. Translation: AAR13065.1. AY353238 mRNA. Translation: AAR13066.1. BT007299 mRNA. Translation: AAP35963.1. AL357131 Genomic DNA. Translation: CAH72012.1. CH471067 Genomic DNA. Translation: EAW91559.1. CH471067 Genomic DNA. Translation: EAW91560.1. BC011526 mRNA. Translation: AAH11526.1. X66362 mRNA. Translation: CAA47005.1. |
| IPI | IPI00394661. IPI00414292. IPI00914963. |
| PIR | S32831. |
| RefSeq | NP_002587.2. NM_002596.3. NP_997667.1. NM_212502.2. NP_997668.1. NM_212503.2. |
| UniGene | Hs.445402. |
3D structure databases | |
| ProteinModelPortal | Q07002. |
| SMR | Q07002. Positions 139-449. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q07002. 5 interactions. |
| MINT | MINT-3294654. |
| STRING | Q07002. |
PTM databases | |
| PhosphoSite | Q07002. |
Polymorphism databases | |
| DMDM | 116242704. |
Proteomic databases | |
| PRIDE | Q07002. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000360066; ENSP00000353176; ENSG00000117266. ENST00000442980; ENSP00000412316; ENSG00000117266. |
| GeneID | 5129. |
| KEGG | hsa:5129. |
Organism-specific databases | |
| CTD | 5129. |
| GeneCards | GC01P205474. |
| H-InvDB | HIX0001514. |
| HGNC | HGNC:8751. CDK18. |
| HPA | HPA045429. |
| MIM | 169190. gene. |
| neXtProt | NX_Q07002. |
| PharmGKB | PA165750739. PA33097. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG18095. |
| HOVERGEN | HBG014652. |
| OMA | LQMESPD. |
| PhylomeDB | Q07002. |
Gene expression databases | |
| ArrayExpress | Q07002. |
| Bgee | Q07002. |
| CleanEx | HS_PCTK3. |
| Genevestigator | Q07002. |
| GermOnline | ENSG00000117266. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_kinase-like_dom. IPR008271. Ser/Thr_kinase_AS. IPR002290. Ser/Thr_kinase_dom. [Graphical view] |
| KO | K15596. |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 19772. |
| SOURCE | Search... |
Entry information
| Entry name | CDK18_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q07002 Secondary accession number(s): Q5VXQ2 Q96F90 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with