Q06889 (EGR3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Early growth response protein 3 Short name=EGR-3 Alternative name(s): Zinc finger protein pilot | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 387 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable transcription factor involved in muscle spindle development. |
| Subcellular location | Nucleus Probable. |
| Developmental stage | In T-cells, expressed 20 minutes following activation. |
| Sequence similarities | Belongs to the EGR C2H2-type zinc-finger protein family. Contains 3 C2H2-type zinc fingers. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q06889-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q06889-2) The sequence of this isoform differs from the canonical sequence as follows: 1-51: MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMAT → MEPCAAWSPRGGR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 387 | 387 | Early growth response protein 3 | PRO_0000047125 | |||||
Regions | |||||||||
| Zinc finger | 275 – 299 | 25 | C2H2-type 1 | ||||||
| Zinc finger | 305 – 327 | 23 | C2H2-type 2 | ||||||
| Zinc finger | 333 – 355 | 23 | C2H2-type 3 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 51 | 51 | MTGKL…NQMAT → MEPCAAWSPRGGR in isoform 2. | VSP_045954 | |||||
Experimental info | |||||||||
| Sequence conflict | 102 | 1 | I → T in BAG58157. Ref.3 | ||||||
| Sequence conflict | 225 | 1 | I → T in AAB19317. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression of PILOT, a putative transcription factor, requires two signals and is cyclosporin A sensitive in T cells." Mages H.W., Stamminger T., Rilke O., Bravo R., Kroczek R.A. Int. Immunol. 5:63-70(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Peripheral blood T-cell. |
| [2] | "EGR3, a novel member of the Egr family of genes encoding immediate-early transcription factors." Patwardhan S., Gashler A., Siegel M.G., Chang L.C., Joseph L.J., Shows T.B., le Beau M.M., Sukhatme V.P. Oncogene 6:917-928(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Testis. |
| [4] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X63741 mRNA. Translation: CAA45275.1. S40832 mRNA. Translation: AAB19317.1. AK292464 mRNA. Translation: BAF85153.1. AK295134 mRNA. Translation: BAG58157.1. AK313604 mRNA. Translation: BAG36369.1. AC105046 Genomic DNA. No translation available. BC104765 mRNA. Translation: AAI04766.1. BC112279 mRNA. Translation: AAI12280.1. |
| IPI | IPI00300178. IPI00984563. |
| PIR | S19885. S60519. |
| RefSeq | NP_001186809.1. NM_001199880.1. NP_001186810.1. NM_001199881.1. NP_004421.2. NM_004430.2. |
| UniGene | Hs.534313. |
3D structure databases | |
| ProteinModelPortal | Q06889. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000318057. |
PTM databases | |
| PhosphoSite | Q06889. |
Polymorphism databases | |
| DMDM | 730328. |
Proteomic databases | |
| PaxDb | Q06889. |
| PRIDE | Q06889. |
Protocols and materials databases | |
| DNASU | 1960. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000317216; ENSP00000318057; ENSG00000179388. ENST00000522910; ENSP00000430310; ENSG00000179388. |
| GeneID | 1960. |
| KEGG | hsa:1960. |
| UCSC | uc003xcm.1. human. |
Organism-specific databases | |
| CTD | 1960. |
| GeneCards | GC08M022545. |
| HGNC | HGNC:3240. EGR3. |
| HPA | CAB009373. HPA006206. |
| MIM | 602419. gene. |
| neXtProt | NX_Q06889. |
| PharmGKB | PA27675. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5048. |
| HOGENOM | HOG000036856. |
| HOVERGEN | HBG003909. |
| InParanoid | Q06889. |
| KO | K12497. |
| OMA | QTMDPIR. |
| OrthoDB | EOG4TTGJ3. |
| PhylomeDB | Q06889. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | nfat_tfpathway. Calcineurin-regulated NFAT-dependent transcription in lymphocytes. |
Gene expression databases | |
| ArrayExpress | Q06889. |
| Bgee | Q06889. |
| CleanEx | HS_EGR3. |
| Genevestigator | Q06889. |
| GermOnline | ENSG00000179388. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.160.60. 3 hits. |
| InterPro | IPR021849. DUF3446. IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] |
| Pfam | PF11928. DUF3446. 1 hit. [Graphical view] |
| SMART | SM00355. ZnF_C2H2. 3 hits. [Graphical view] |
| PROSITE | PS00028. ZINC_FINGER_C2H2_1. 3 hits. PS50157. ZINC_FINGER_C2H2_2. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | EGR3. human. |
| GenomeRNAi | 1960. |
| NextBio | 7951. |
| SOURCE | Search... |
Entry information
| Entry name | EGR3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q06889 Secondary accession number(s): A8K8U9 Q2M3W2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
