Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q06889 (EGR3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 122. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Early growth response protein 3

Short name=EGR-3
Alternative name(s):
Zinc finger protein pilot
Gene names
Name:EGR3
Synonyms:PILOT
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length387 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Probable transcription factor involved in muscle spindle development.

Subcellular location

Nucleus Probable.

Developmental stage

In T-cells, expressed 20 minutes following activation.

Sequence similarities

Belongs to the EGR C2H2-type zinc-finger protein family.

Contains 3 C2H2-type zinc fingers.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   DomainRepeat
Zinc-finger
   LigandDNA-binding
Metal-binding
Zinc
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell migration involved in sprouting angiogenesis

Inferred from direct assay PubMed 18059339. Source: BHF-UCL

cellular response to cAMP

Inferred from Biological aspect of Ancestor. Source: RefGenome

cellular response to fibroblast growth factor stimulus

Inferred from mutant phenotype PubMed 18059339. Source: BHF-UCL

cellular response to gonadotropin stimulus

Inferred from Biological aspect of Ancestor. Source: RefGenome

cellular response to vascular endothelial growth factor stimulus

Inferred from mutant phenotype PubMed 18059339. Source: BHF-UCL

circadian rhythm

Traceable author statement PubMed 9488654. Source: ProtInc

endothelial cell chemotaxis

Inferred from mutant phenotype PubMed 18059339. Source: BHF-UCL

muscle organ development

Traceable author statement PubMed 9731539. Source: ProtInc

negative regulation of apoptotic process

Inferred from mutant phenotype PubMed 18059339. Source: BHF-UCL

neuromuscular synaptic transmission

Inferred from electronic annotation. Source: Ensembl

peripheral nervous system development

Inferred from electronic annotation. Source: Ensembl

positive regulation of endothelial cell proliferation

Inferred from mutant phenotype PubMed 18059339. Source: BHF-UCL

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentcytoplasm

Inferred from Biological aspect of Ancestor. Source: RefGenome

nucleus

Inferred from Biological aspect of Ancestor. Source: RefGenome

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

sequence-specific DNA binding transcription factor activity

Traceable author statement Ref.2PubMed 9731539. Source: ProtInc

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q06889-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q06889-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMAT → MEPCAAWSPRGGR
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 387387Early growth response protein 3
PRO_0000047125

Regions

Zinc finger275 – 29925C2H2-type 1
Zinc finger305 – 32723C2H2-type 2
Zinc finger333 – 35523C2H2-type 3

Natural variations

Alternative sequence1 – 5151MTGKL…NQMAT → MEPCAAWSPRGGR in isoform 2.
VSP_045954

Experimental info

Sequence conflict1021I → T in BAG58157. Ref.3
Sequence conflict2251I → T in AAB19317. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 1, 1995. Version 1.
Checksum: 77FAF7D5A278C68E

FASTA38742,613
        10         20         30         40         50         60 
MTGKLAEKLP VTMSSLLNQL PDNLYPEEIP SALNLFSGSS DSVVHYNQMA TENVMDIGLT 

        70         80         90        100        110        120 
NEKPNPELSY SGSFQPAPGN KTVTYLGKFA FDSPSNWCQD NIISLMSAGI LGVPPASGAL 

       130        140        150        160        170        180 
STQTSTASMV QPPQGDVEAM YPALPPYSNC GDLYSEPVSF HDPQGNPGLA YSPQDYQSAK 

       190        200        210        220        230        240 
PALDSNLFPM IPDYNLYHHP NDMGSIPEHK PFQGMDPIRV NPPPITPLET IKAFKDKQIH 

       250        260        270        280        290        300 
PGFGSLPQPP LTLKPIRPRK YPNRPSKTPL HERPHACPAE GCDRRFSRSD ELTRHLRIHT 

       310        320        330        340        350        360 
GHKPFQCRIC MRSFSRSDHL TTHIRTHTGE KPFACEFCGR KFARSDERKR HAKIHLKQKE 

       370        380 
KKAEKGGAPS ASSAPPVSLA PVVTTCA 

« Hide

Isoform 2 [UniParc].

Checksum: 32ED293BBFB500B7
Show »

FASTA34938,478

References

« Hide 'large scale' references
[1]"Expression of PILOT, a putative transcription factor, requires two signals and is cyclosporin A sensitive in T cells."
Mages H.W., Stamminger T., Rilke O., Bravo R., Kroczek R.A.
Int. Immunol. 5:63-70(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Peripheral blood T-cell.
[2]"EGR3, a novel member of the Egr family of genes encoding immediate-early transcription factors."
Patwardhan S., Gashler A., Siegel M.G., Chang L.C., Joseph L.J., Shows T.B., le Beau M.M., Sukhatme V.P.
Oncogene 6:917-928(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain and Testis.
[4]"DNA sequence and analysis of human chromosome 8."
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. expand/collapse author list , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X63741 mRNA. Translation: CAA45275.1.
S40832 mRNA. Translation: AAB19317.1.
AK292464 mRNA. Translation: BAF85153.1.
AK295134 mRNA. Translation: BAG58157.1.
AK313604 mRNA. Translation: BAG36369.1.
AC105046 Genomic DNA. No translation available.
BC104765 mRNA. Translation: AAI04766.1.
BC112279 mRNA. Translation: AAI12280.1.
CCDSCCDS56528.1. [Q06889-2]
CCDS6033.1. [Q06889-1]
PIRS19885. S60519.
RefSeqNP_001186809.1. NM_001199880.1. [Q06889-2]
NP_001186810.1. NM_001199881.1.
NP_004421.2. NM_004430.2. [Q06889-1]
XP_005273483.1. XM_005273426.1. [Q06889-2]
UniGeneHs.534313.

3D structure databases

ProteinModelPortalQ06889.
SMRQ06889. Positions 273-356.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

MINTMINT-234110.
STRING9606.ENSP00000318057.

PTM databases

PhosphoSiteQ06889.

Polymorphism databases

DMDM730328.

Proteomic databases

PaxDbQ06889.
PRIDEQ06889.

Protocols and materials databases

DNASU1960.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000317216; ENSP00000318057; ENSG00000179388. [Q06889-1]
ENST00000522910; ENSP00000430310; ENSG00000179388. [Q06889-2]
GeneID1960.
KEGGhsa:1960.
UCSCuc003xcm.1. human. [Q06889-1]

Organism-specific databases

CTD1960.
GeneCardsGC08M022545.
HGNCHGNC:3240. EGR3.
HPACAB009373.
HPA006206.
MIM602419. gene.
neXtProtNX_Q06889.
PharmGKBPA27675.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOGENOMHOG000036856.
HOVERGENHBG003909.
InParanoidQ06889.
KOK12497.
OMAQTMDPIR.
OrthoDBEOG75XGKR.
PhylomeDBQ06889.
TreeFamTF318980.

Enzyme and pathway databases

SignaLinkQ06889.

Gene expression databases

ArrayExpressQ06889.
BgeeQ06889.
CleanExHS_EGR3.
GenevestigatorQ06889.

Family and domain databases

Gene3D3.30.160.60. 3 hits.
InterProIPR021849. DUF3446.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamPF11928. DUF3446. 1 hit.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSEGR3. human.
GeneWikiEGR3.
GenomeRNAi1960.
NextBio7951.
PROQ06889.
SOURCESearch...

Entry information

Entry nameEGR3_HUMAN
AccessionPrimary (citable) accession number: Q06889
Secondary accession number(s): A8K8U9 expand/collapse secondary AC list , B4DHJ5, E7EW38, Q2M3W2
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: July 9, 2014
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM