Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q06889

- EGR3_HUMAN

UniProt

Q06889 - EGR3_HUMAN

Protein

Early growth response protein 3

Gene

EGR3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 123 (01 Oct 2014)
      Sequence version 1 (01 Feb 1995)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable transcription factor involved in muscle spindle development.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri275 – 29925C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri305 – 32723C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri333 – 35523C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW
    3. sequence-specific DNA binding transcription factor activity Source: ProtInc

    GO - Biological processi

    1. cell migration involved in sprouting angiogenesis Source: BHF-UCL
    2. cellular response to cAMP Source: RefGenome
    3. cellular response to fibroblast growth factor stimulus Source: BHF-UCL
    4. cellular response to gonadotropin stimulus Source: RefGenome
    5. cellular response to vascular endothelial growth factor stimulus Source: BHF-UCL
    6. circadian rhythm Source: ProtInc
    7. endothelial cell chemotaxis Source: BHF-UCL
    8. muscle organ development Source: ProtInc
    9. negative regulation of apoptotic process Source: BHF-UCL
    10. neuromuscular synaptic transmission Source: Ensembl
    11. peripheral nervous system development Source: Ensembl
    12. positive regulation of endothelial cell proliferation Source: BHF-UCL
    13. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Enzyme and pathway databases

    SignaLinkiQ06889.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Early growth response protein 3
    Short name:
    EGR-3
    Alternative name(s):
    Zinc finger protein pilot
    Gene namesi
    Name:EGR3
    Synonyms:PILOT
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:3240. EGR3.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. cytoplasm Source: RefGenome
    2. nucleus Source: RefGenome

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA27675.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 387387Early growth response protein 3PRO_0000047125Add
    BLAST

    Proteomic databases

    PaxDbiQ06889.
    PRIDEiQ06889.

    PTM databases

    PhosphoSiteiQ06889.

    Expressioni

    Developmental stagei

    In T-cells, expressed 20 minutes following activation.

    Gene expression databases

    ArrayExpressiQ06889.
    BgeeiQ06889.
    CleanExiHS_EGR3.
    GenevestigatoriQ06889.

    Organism-specific databases

    HPAiCAB009373.
    HPA006206.

    Interactioni

    Protein-protein interaction databases

    MINTiMINT-234110.
    STRINGi9606.ENSP00000318057.

    Structurei

    3D structure databases

    ProteinModelPortaliQ06889.
    SMRiQ06889. Positions 273-356.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Contains 3 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri275 – 29925C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri305 – 32723C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri333 – 35523C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOGENOMiHOG000036856.
    HOVERGENiHBG003909.
    InParanoidiQ06889.
    KOiK12497.
    OMAiQTMDPIR.
    OrthoDBiEOG75XGKR.
    PhylomeDBiQ06889.
    TreeFamiTF318980.

    Family and domain databases

    Gene3Di3.30.160.60. 3 hits.
    InterProiIPR021849. DUF3446.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF11928. DUF3446. 1 hit.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 3 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
    PS50157. ZINC_FINGER_C2H2_2. 3 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q06889-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTGKLAEKLP VTMSSLLNQL PDNLYPEEIP SALNLFSGSS DSVVHYNQMA    50
    TENVMDIGLT NEKPNPELSY SGSFQPAPGN KTVTYLGKFA FDSPSNWCQD 100
    NIISLMSAGI LGVPPASGAL STQTSTASMV QPPQGDVEAM YPALPPYSNC 150
    GDLYSEPVSF HDPQGNPGLA YSPQDYQSAK PALDSNLFPM IPDYNLYHHP 200
    NDMGSIPEHK PFQGMDPIRV NPPPITPLET IKAFKDKQIH PGFGSLPQPP 250
    LTLKPIRPRK YPNRPSKTPL HERPHACPAE GCDRRFSRSD ELTRHLRIHT 300
    GHKPFQCRIC MRSFSRSDHL TTHIRTHTGE KPFACEFCGR KFARSDERKR 350
    HAKIHLKQKE KKAEKGGAPS ASSAPPVSLA PVVTTCA 387
    Length:387
    Mass (Da):42,613
    Last modified:February 1, 1995 - v1
    Checksum:i77FAF7D5A278C68E
    GO
    Isoform 2 (identifier: Q06889-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-51: MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMAT → MEPCAAWSPRGGR

    Note: No experimental confirmation available.

    Show »
    Length:349
    Mass (Da):38,478
    Checksum:i32ED293BBFB500B7
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti102 – 1021I → T in BAG58157. (PubMed:14702039)Curated
    Sequence conflicti225 – 2251I → T in AAB19317. (PubMed:1906159)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5151MTGKL…NQMAT → MEPCAAWSPRGGR in isoform 2. 1 PublicationVSP_045954Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X63741 mRNA. Translation: CAA45275.1.
    S40832 mRNA. Translation: AAB19317.1.
    AK292464 mRNA. Translation: BAF85153.1.
    AK295134 mRNA. Translation: BAG58157.1.
    AK313604 mRNA. Translation: BAG36369.1.
    AC105046 Genomic DNA. No translation available.
    BC104765 mRNA. Translation: AAI04766.1.
    BC112279 mRNA. Translation: AAI12280.1.
    CCDSiCCDS56528.1. [Q06889-2]
    CCDS6033.1. [Q06889-1]
    PIRiS60519. S19885.
    RefSeqiNP_001186809.1. NM_001199880.1. [Q06889-2]
    NP_001186810.1. NM_001199881.1.
    NP_004421.2. NM_004430.2. [Q06889-1]
    XP_005273483.1. XM_005273426.1. [Q06889-2]
    UniGeneiHs.534313.

    Genome annotation databases

    EnsembliENST00000317216; ENSP00000318057; ENSG00000179388. [Q06889-1]
    ENST00000522910; ENSP00000430310; ENSG00000179388. [Q06889-2]
    GeneIDi1960.
    KEGGihsa:1960.
    UCSCiuc003xcm.1. human. [Q06889-1]

    Polymorphism databases

    DMDMi730328.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X63741 mRNA. Translation: CAA45275.1 .
    S40832 mRNA. Translation: AAB19317.1 .
    AK292464 mRNA. Translation: BAF85153.1 .
    AK295134 mRNA. Translation: BAG58157.1 .
    AK313604 mRNA. Translation: BAG36369.1 .
    AC105046 Genomic DNA. No translation available.
    BC104765 mRNA. Translation: AAI04766.1 .
    BC112279 mRNA. Translation: AAI12280.1 .
    CCDSi CCDS56528.1. [Q06889-2 ]
    CCDS6033.1. [Q06889-1 ]
    PIRi S60519. S19885.
    RefSeqi NP_001186809.1. NM_001199880.1. [Q06889-2 ]
    NP_001186810.1. NM_001199881.1.
    NP_004421.2. NM_004430.2. [Q06889-1 ]
    XP_005273483.1. XM_005273426.1. [Q06889-2 ]
    UniGenei Hs.534313.

    3D structure databases

    ProteinModelPortali Q06889.
    SMRi Q06889. Positions 273-356.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    MINTi MINT-234110.
    STRINGi 9606.ENSP00000318057.

    PTM databases

    PhosphoSitei Q06889.

    Polymorphism databases

    DMDMi 730328.

    Proteomic databases

    PaxDbi Q06889.
    PRIDEi Q06889.

    Protocols and materials databases

    DNASUi 1960.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000317216 ; ENSP00000318057 ; ENSG00000179388 . [Q06889-1 ]
    ENST00000522910 ; ENSP00000430310 ; ENSG00000179388 . [Q06889-2 ]
    GeneIDi 1960.
    KEGGi hsa:1960.
    UCSCi uc003xcm.1. human. [Q06889-1 ]

    Organism-specific databases

    CTDi 1960.
    GeneCardsi GC08M022545.
    HGNCi HGNC:3240. EGR3.
    HPAi CAB009373.
    HPA006206.
    MIMi 602419. gene.
    neXtProti NX_Q06889.
    PharmGKBi PA27675.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOGENOMi HOG000036856.
    HOVERGENi HBG003909.
    InParanoidi Q06889.
    KOi K12497.
    OMAi QTMDPIR.
    OrthoDBi EOG75XGKR.
    PhylomeDBi Q06889.
    TreeFami TF318980.

    Enzyme and pathway databases

    SignaLinki Q06889.

    Miscellaneous databases

    ChiTaRSi EGR3. human.
    GeneWikii EGR3.
    GenomeRNAii 1960.
    NextBioi 7951.
    PROi Q06889.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q06889.
    Bgeei Q06889.
    CleanExi HS_EGR3.
    Genevestigatori Q06889.

    Family and domain databases

    Gene3Di 3.30.160.60. 3 hits.
    InterProi IPR021849. DUF3446.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF11928. DUF3446. 1 hit.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 3 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 3 hits.
    PS50157. ZINC_FINGER_C2H2_2. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Expression of PILOT, a putative transcription factor, requires two signals and is cyclosporin A sensitive in T cells."
      Mages H.W., Stamminger T., Rilke O., Bravo R., Kroczek R.A.
      Int. Immunol. 5:63-70(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Peripheral blood T-cell.
    2. "EGR3, a novel member of the Egr family of genes encoding immediate-early transcription factors."
      Patwardhan S., Gashler A., Siegel M.G., Chang L.C., Joseph L.J., Shows T.B., le Beau M.M., Sukhatme V.P.
      Oncogene 6:917-928(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Testis.
    4. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.

    Entry informationi

    Entry nameiEGR3_HUMAN
    AccessioniPrimary (citable) accession number: Q06889
    Secondary accession number(s): A8K8U9
    , B4DHJ5, E7EW38, Q2M3W2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1995
    Last sequence update: February 1, 1995
    Last modified: October 1, 2014
    This is version 123 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3