Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Early growth response protein 3

Gene

EGR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Probable transcription factor involved in muscle spindle development.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri275 – 299C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri305 – 327C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri333 – 355C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

  • cell migration involved in sprouting angiogenesis Source: BHF-UCL
  • cellular response to fibroblast growth factor stimulus Source: BHF-UCL
  • cellular response to vascular endothelial growth factor stimulus Source: BHF-UCL
  • circadian rhythm Source: ProtInc
  • endothelial cell chemotaxis Source: BHF-UCL
  • muscle organ development Source: ProtInc
  • negative regulation of apoptotic process Source: BHF-UCL
  • neuromuscular synaptic transmission Source: Ensembl
  • peripheral nervous system development Source: Ensembl
  • positive regulation of endothelial cell proliferation Source: BHF-UCL
  • positive regulation of T cell differentiation in thymus Source: Ensembl
  • positive regulation of transcription by RNA polymerase II Source: Ensembl
  • regulation of gamma-delta T cell differentiation Source: Ensembl
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLinkiQ06889
SIGNORiQ06889

Names & Taxonomyi

Protein namesi
Recommended name:
Early growth response protein 3
Short name:
EGR-3
Alternative name(s):
Zinc finger protein pilot
Gene namesi
Name:EGR3
Synonyms:PILOT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000179388.8
HGNCiHGNC:3240 EGR3
MIMi602419 gene
neXtProtiNX_Q06889

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi1960
OpenTargetsiENSG00000179388
PharmGKBiPA27675

Polymorphism and mutation databases

BioMutaiEGR3
DMDMi730328

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000471251 – 387Early growth response protein 3Add BLAST387

Proteomic databases

PaxDbiQ06889
PeptideAtlasiQ06889
PRIDEiQ06889
TopDownProteomicsiQ06889-1 [Q06889-1]

PTM databases

iPTMnetiQ06889
PhosphoSitePlusiQ06889

Expressioni

Developmental stagei

In T-cells, expressed 20 minutes following activation.

Gene expression databases

BgeeiENSG00000179388
CleanExiHS_EGR3
ExpressionAtlasiQ06889 baseline and differential
GenevisibleiQ06889 HS

Organism-specific databases

HPAiCAB009373
HPA006206

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000318057

Structurei

3D structure databases

ProteinModelPortaliQ06889
SMRiQ06889
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri275 – 299C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri305 – 327C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri333 – 355C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00550000074455
HOGENOMiHOG000036856
HOVERGENiHBG003909
InParanoidiQ06889
KOiK12497
OMAiSGWCSDN
OrthoDBiEOG091G08QI
PhylomeDBiQ06889
TreeFamiTF318980

Family and domain databases

InterProiView protein in InterPro
IPR021849 EGR
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF11928 DUF3446, 1 hit
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 3 hits
SUPFAMiSSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q06889-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTGKLAEKLP VTMSSLLNQL PDNLYPEEIP SALNLFSGSS DSVVHYNQMA
60 70 80 90 100
TENVMDIGLT NEKPNPELSY SGSFQPAPGN KTVTYLGKFA FDSPSNWCQD
110 120 130 140 150
NIISLMSAGI LGVPPASGAL STQTSTASMV QPPQGDVEAM YPALPPYSNC
160 170 180 190 200
GDLYSEPVSF HDPQGNPGLA YSPQDYQSAK PALDSNLFPM IPDYNLYHHP
210 220 230 240 250
NDMGSIPEHK PFQGMDPIRV NPPPITPLET IKAFKDKQIH PGFGSLPQPP
260 270 280 290 300
LTLKPIRPRK YPNRPSKTPL HERPHACPAE GCDRRFSRSD ELTRHLRIHT
310 320 330 340 350
GHKPFQCRIC MRSFSRSDHL TTHIRTHTGE KPFACEFCGR KFARSDERKR
360 370 380
HAKIHLKQKE KKAEKGGAPS ASSAPPVSLA PVVTTCA
Length:387
Mass (Da):42,613
Last modified:February 1, 1995 - v1
Checksum:i77FAF7D5A278C68E
GO
Isoform 2 (identifier: Q06889-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMAT → MEPCAAWSPRGGR

Note: No experimental confirmation available.
Show »
Length:349
Mass (Da):38,478
Checksum:i32ED293BBFB500B7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti102I → T in BAG58157 (PubMed:14702039).Curated1
Sequence conflicti225I → T in AAB19317 (PubMed:1906159).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0459541 – 51MTGKL…NQMAT → MEPCAAWSPRGGR in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X63741 mRNA Translation: CAA45275.1
S40832 mRNA Translation: AAB19317.1
AK292464 mRNA Translation: BAF85153.1
AK295134 mRNA Translation: BAG58157.1
AK313604 mRNA Translation: BAG36369.1
AC105046 Genomic DNA No translation available.
BC104765 mRNA Translation: AAI04766.1
BC112279 mRNA Translation: AAI12280.1
CCDSiCCDS56528.1 [Q06889-2]
CCDS6033.1 [Q06889-1]
PIRiS60519 S19885
RefSeqiNP_001186809.1, NM_001199880.1 [Q06889-2]
NP_001186810.1, NM_001199881.1
NP_004421.2, NM_004430.2 [Q06889-1]
XP_005273483.1, XM_005273426.3 [Q06889-2]
UniGeneiHs.534313

Genome annotation databases

EnsembliENST00000317216; ENSP00000318057; ENSG00000179388 [Q06889-1]
ENST00000522910; ENSP00000430310; ENSG00000179388 [Q06889-2]
GeneIDi1960
KEGGihsa:1960
UCSCiuc003xcm.2 human [Q06889-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiEGR3_HUMAN
AccessioniPrimary (citable) accession number: Q06889
Secondary accession number(s): A8K8U9
, B4DHJ5, E7EW38, Q2M3W2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: May 23, 2018
This is version 151 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health