SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q06889

- EGR3_HUMAN

UniProt

Q06889 - EGR3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Early growth response protein 3
Gene
EGR3, PILOT
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Probable transcription factor involved in muscle spindle development.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri275 – 29925C2H2-type 1
Add
BLAST
Zinc fingeri305 – 32723C2H2-type 2
Add
BLAST
Zinc fingeri333 – 35523C2H2-type 3
Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW
  3. sequence-specific DNA binding transcription factor activity Source: ProtInc
Complete GO annotation...

GO - Biological processi

  1. cell migration involved in sprouting angiogenesis Source: BHF-UCL
  2. cellular response to cAMP Source: RefGenome
  3. cellular response to fibroblast growth factor stimulus Source: BHF-UCL
  4. cellular response to gonadotropin stimulus Source: RefGenome
  5. cellular response to vascular endothelial growth factor stimulus Source: BHF-UCL
  6. circadian rhythm Source: ProtInc
  7. endothelial cell chemotaxis Source: BHF-UCL
  8. muscle organ development Source: ProtInc
  9. negative regulation of apoptotic process Source: BHF-UCL
  10. neuromuscular synaptic transmission Source: Ensembl
  11. peripheral nervous system development Source: Ensembl
  12. positive regulation of endothelial cell proliferation Source: BHF-UCL
  13. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

SignaLinkiQ06889.

Names & Taxonomyi

Protein namesi
Recommended name:
Early growth response protein 3
Short name:
EGR-3
Alternative name(s):
Zinc finger protein pilot
Gene namesi
Name:EGR3
Synonyms:PILOT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:3240. EGR3.

Subcellular locationi

Nucleus Inferred

GO - Cellular componenti

  1. cytoplasm Source: RefGenome
  2. nucleus Source: RefGenome
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27675.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 387387Early growth response protein 3
PRO_0000047125Add
BLAST

Proteomic databases

PaxDbiQ06889.
PRIDEiQ06889.

PTM databases

PhosphoSiteiQ06889.

Expressioni

Developmental stagei

In T-cells, expressed 20 minutes following activation.

Gene expression databases

ArrayExpressiQ06889.
BgeeiQ06889.
CleanExiHS_EGR3.
GenevestigatoriQ06889.

Organism-specific databases

HPAiCAB009373.
HPA006206.

Interactioni

Protein-protein interaction databases

MINTiMINT-234110.
STRINGi9606.ENSP00000318057.

Structurei

3D structure databases

ProteinModelPortaliQ06889.
SMRiQ06889. Positions 273-356.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
HOGENOMiHOG000036856.
HOVERGENiHBG003909.
InParanoidiQ06889.
KOiK12497.
OMAiQTMDPIR.
OrthoDBiEOG75XGKR.
PhylomeDBiQ06889.
TreeFamiTF318980.

Family and domain databases

Gene3Di3.30.160.60. 3 hits.
InterProiIPR021849. DUF3446.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF11928. DUF3446. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q06889-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTGKLAEKLP VTMSSLLNQL PDNLYPEEIP SALNLFSGSS DSVVHYNQMA    50
TENVMDIGLT NEKPNPELSY SGSFQPAPGN KTVTYLGKFA FDSPSNWCQD 100
NIISLMSAGI LGVPPASGAL STQTSTASMV QPPQGDVEAM YPALPPYSNC 150
GDLYSEPVSF HDPQGNPGLA YSPQDYQSAK PALDSNLFPM IPDYNLYHHP 200
NDMGSIPEHK PFQGMDPIRV NPPPITPLET IKAFKDKQIH PGFGSLPQPP 250
LTLKPIRPRK YPNRPSKTPL HERPHACPAE GCDRRFSRSD ELTRHLRIHT 300
GHKPFQCRIC MRSFSRSDHL TTHIRTHTGE KPFACEFCGR KFARSDERKR 350
HAKIHLKQKE KKAEKGGAPS ASSAPPVSLA PVVTTCA 387
Length:387
Mass (Da):42,613
Last modified:February 1, 1995 - v1
Checksum:i77FAF7D5A278C68E
GO
Isoform 2 (identifier: Q06889-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMAT → MEPCAAWSPRGGR

Note: No experimental confirmation available.

Show »
Length:349
Mass (Da):38,478
Checksum:i32ED293BBFB500B7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5151MTGKL…NQMAT → MEPCAAWSPRGGR in isoform 2.
VSP_045954Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti102 – 1021I → T in BAG58157. 1 Publication
Sequence conflicti225 – 2251I → T in AAB19317. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X63741 mRNA. Translation: CAA45275.1.
S40832 mRNA. Translation: AAB19317.1.
AK292464 mRNA. Translation: BAF85153.1.
AK295134 mRNA. Translation: BAG58157.1.
AK313604 mRNA. Translation: BAG36369.1.
AC105046 Genomic DNA. No translation available.
BC104765 mRNA. Translation: AAI04766.1.
BC112279 mRNA. Translation: AAI12280.1.
CCDSiCCDS56528.1. [Q06889-2]
CCDS6033.1. [Q06889-1]
PIRiS60519. S19885.
RefSeqiNP_001186809.1. NM_001199880.1. [Q06889-2]
NP_001186810.1. NM_001199881.1.
NP_004421.2. NM_004430.2. [Q06889-1]
XP_005273483.1. XM_005273426.1. [Q06889-2]
UniGeneiHs.534313.

Genome annotation databases

EnsembliENST00000317216; ENSP00000318057; ENSG00000179388. [Q06889-1]
ENST00000522910; ENSP00000430310; ENSG00000179388. [Q06889-2]
GeneIDi1960.
KEGGihsa:1960.
UCSCiuc003xcm.1. human. [Q06889-1]

Polymorphism databases

DMDMi730328.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X63741 mRNA. Translation: CAA45275.1 .
S40832 mRNA. Translation: AAB19317.1 .
AK292464 mRNA. Translation: BAF85153.1 .
AK295134 mRNA. Translation: BAG58157.1 .
AK313604 mRNA. Translation: BAG36369.1 .
AC105046 Genomic DNA. No translation available.
BC104765 mRNA. Translation: AAI04766.1 .
BC112279 mRNA. Translation: AAI12280.1 .
CCDSi CCDS56528.1. [Q06889-2 ]
CCDS6033.1. [Q06889-1 ]
PIRi S60519. S19885.
RefSeqi NP_001186809.1. NM_001199880.1. [Q06889-2 ]
NP_001186810.1. NM_001199881.1.
NP_004421.2. NM_004430.2. [Q06889-1 ]
XP_005273483.1. XM_005273426.1. [Q06889-2 ]
UniGenei Hs.534313.

3D structure databases

ProteinModelPortali Q06889.
SMRi Q06889. Positions 273-356.
ModBasei Search...

Protein-protein interaction databases

MINTi MINT-234110.
STRINGi 9606.ENSP00000318057.

PTM databases

PhosphoSitei Q06889.

Polymorphism databases

DMDMi 730328.

Proteomic databases

PaxDbi Q06889.
PRIDEi Q06889.

Protocols and materials databases

DNASUi 1960.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000317216 ; ENSP00000318057 ; ENSG00000179388 . [Q06889-1 ]
ENST00000522910 ; ENSP00000430310 ; ENSG00000179388 . [Q06889-2 ]
GeneIDi 1960.
KEGGi hsa:1960.
UCSCi uc003xcm.1. human. [Q06889-1 ]

Organism-specific databases

CTDi 1960.
GeneCardsi GC08M022545.
HGNCi HGNC:3240. EGR3.
HPAi CAB009373.
HPA006206.
MIMi 602419. gene.
neXtProti NX_Q06889.
PharmGKBi PA27675.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
HOGENOMi HOG000036856.
HOVERGENi HBG003909.
InParanoidi Q06889.
KOi K12497.
OMAi QTMDPIR.
OrthoDBi EOG75XGKR.
PhylomeDBi Q06889.
TreeFami TF318980.

Enzyme and pathway databases

SignaLinki Q06889.

Miscellaneous databases

ChiTaRSi EGR3. human.
GeneWikii EGR3.
GenomeRNAii 1960.
NextBioi 7951.
PROi Q06889.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q06889.
Bgeei Q06889.
CleanExi HS_EGR3.
Genevestigatori Q06889.

Family and domain databases

Gene3Di 3.30.160.60. 3 hits.
InterProi IPR021849. DUF3446.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF11928. DUF3446. 1 hit.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 3 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Expression of PILOT, a putative transcription factor, requires two signals and is cyclosporin A sensitive in T cells."
    Mages H.W., Stamminger T., Rilke O., Bravo R., Kroczek R.A.
    Int. Immunol. 5:63-70(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Peripheral blood T-cell.
  2. "EGR3, a novel member of the Egr family of genes encoding immediate-early transcription factors."
    Patwardhan S., Gashler A., Siegel M.G., Chang L.C., Joseph L.J., Shows T.B., le Beau M.M., Sukhatme V.P.
    Oncogene 6:917-928(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Testis.
  4. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiEGR3_HUMAN
AccessioniPrimary (citable) accession number: Q06889
Secondary accession number(s): A8K8U9
, B4DHJ5, E7EW38, Q2M3W2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: July 9, 2014
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi