Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Early growth response protein 3

Gene

EGR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Probable transcription factor involved in muscle spindle development.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri275 – 299C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri305 – 327C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri333 – 355C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • metal ion binding Source: UniProtKB-KW
  • transcription factor activity, sequence-specific DNA binding Source: ProtInc

GO - Biological processi

  • cell migration involved in sprouting angiogenesis Source: BHF-UCL
  • cellular response to fibroblast growth factor stimulus Source: BHF-UCL
  • cellular response to vascular endothelial growth factor stimulus Source: BHF-UCL
  • circadian rhythm Source: ProtInc
  • endothelial cell chemotaxis Source: BHF-UCL
  • muscle organ development Source: ProtInc
  • negative regulation of apoptotic process Source: BHF-UCL
  • positive regulation of endothelial cell proliferation Source: BHF-UCL
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLinkiQ06889.

Names & Taxonomyi

Protein namesi
Recommended name:
Early growth response protein 3
Short name:
EGR-3
Alternative name(s):
Zinc finger protein pilot
Gene namesi
Name:EGR3
Synonyms:PILOT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000179388.8.
HGNCiHGNC:3240. EGR3.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi1960.
OpenTargetsiENSG00000179388.
PharmGKBiPA27675.

Polymorphism and mutation databases

BioMutaiEGR3.
DMDMi730328.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000471251 – 387Early growth response protein 3Add BLAST387

Proteomic databases

PaxDbiQ06889.
PeptideAtlasiQ06889.
PRIDEiQ06889.
TopDownProteomicsiQ06889-1. [Q06889-1]

PTM databases

iPTMnetiQ06889.
PhosphoSitePlusiQ06889.

Expressioni

Developmental stagei

In T-cells, expressed 20 minutes following activation.

Gene expression databases

BgeeiENSG00000179388.
CleanExiHS_EGR3.
ExpressionAtlasiQ06889. baseline and differential.
GenevisibleiQ06889. HS.

Organism-specific databases

HPAiCAB009373.
HPA006206.

Interactioni

Protein-protein interaction databases

MINTiMINT-234110.
STRINGi9606.ENSP00000318057.

Structurei

3D structure databases

ProteinModelPortaliQ06889.
SMRiQ06889.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri275 – 299C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri305 – 327C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri333 – 355C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00550000074455.
HOGENOMiHOG000036856.
HOVERGENiHBG003909.
InParanoidiQ06889.
KOiK12497.
OMAiGWCSDNN.
OrthoDBiEOG091G08QI.
PhylomeDBiQ06889.
TreeFamiTF318980.

Family and domain databases

InterProiView protein in InterPro
IPR021849. DUF3446.
IPR013087. Znf_C2H2_type.
PfamiView protein in Pfam
PF11928. DUF3446. 1 hit.
SMARTiView protein in SMART
SM00355. ZnF_C2H2. 3 hits.
SUPFAMiSSF57667. SSF57667. 2 hits.
PROSITEiView protein in PROSITE
PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q06889-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTGKLAEKLP VTMSSLLNQL PDNLYPEEIP SALNLFSGSS DSVVHYNQMA
60 70 80 90 100
TENVMDIGLT NEKPNPELSY SGSFQPAPGN KTVTYLGKFA FDSPSNWCQD
110 120 130 140 150
NIISLMSAGI LGVPPASGAL STQTSTASMV QPPQGDVEAM YPALPPYSNC
160 170 180 190 200
GDLYSEPVSF HDPQGNPGLA YSPQDYQSAK PALDSNLFPM IPDYNLYHHP
210 220 230 240 250
NDMGSIPEHK PFQGMDPIRV NPPPITPLET IKAFKDKQIH PGFGSLPQPP
260 270 280 290 300
LTLKPIRPRK YPNRPSKTPL HERPHACPAE GCDRRFSRSD ELTRHLRIHT
310 320 330 340 350
GHKPFQCRIC MRSFSRSDHL TTHIRTHTGE KPFACEFCGR KFARSDERKR
360 370 380
HAKIHLKQKE KKAEKGGAPS ASSAPPVSLA PVVTTCA
Length:387
Mass (Da):42,613
Last modified:February 1, 1995 - v1
Checksum:i77FAF7D5A278C68E
GO
Isoform 2 (identifier: Q06889-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMAT → MEPCAAWSPRGGR

Note: No experimental confirmation available.
Show »
Length:349
Mass (Da):38,478
Checksum:i32ED293BBFB500B7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti102I → T in BAG58157 (PubMed:14702039).Curated1
Sequence conflicti225I → T in AAB19317 (PubMed:1906159).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0459541 – 51MTGKL…NQMAT → MEPCAAWSPRGGR in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X63741 mRNA. Translation: CAA45275.1.
S40832 mRNA. Translation: AAB19317.1.
AK292464 mRNA. Translation: BAF85153.1.
AK295134 mRNA. Translation: BAG58157.1.
AK313604 mRNA. Translation: BAG36369.1.
AC105046 Genomic DNA. No translation available.
BC104765 mRNA. Translation: AAI04766.1.
BC112279 mRNA. Translation: AAI12280.1.
CCDSiCCDS56528.1. [Q06889-2]
CCDS6033.1. [Q06889-1]
PIRiS60519. S19885.
RefSeqiNP_001186809.1. NM_001199880.1. [Q06889-2]
NP_001186810.1. NM_001199881.1.
NP_004421.2. NM_004430.2. [Q06889-1]
XP_005273483.1. XM_005273426.3. [Q06889-2]
UniGeneiHs.534313.

Genome annotation databases

EnsembliENST00000317216; ENSP00000318057; ENSG00000179388. [Q06889-1]
ENST00000522910; ENSP00000430310; ENSG00000179388. [Q06889-2]
GeneIDi1960.
KEGGihsa:1960.
UCSCiuc003xcm.2. human. [Q06889-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiEGR3_HUMAN
AccessioniPrimary (citable) accession number: Q06889
Secondary accession number(s): A8K8U9
, B4DHJ5, E7EW38, Q2M3W2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: September 27, 2017
This is version 145 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families