Q06547 (GABP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 141.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: GA-binding protein subunit beta-1 Short name=GABP subunit beta-1 Short name=GABPB-1 Alternative name(s): GABP subunit beta-2 Short name=GABPB-2 Nuclear respiratory factor 2 Transcription factor E4TF1-47 Transcription factor E4TF1-53 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 395 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcription factor capable of interacting with purine rich repeats (GA repeats). Necessary for the expression of the Adenovirus E4 gene. Ref.9 Ref.10 |
| Subunit structure | Heterotetramer of two alpha and two beta subunits. Interacts with HCFC1, causing repression of transcriptional activity. Ref.10 |
| Subcellular location | |
| Sequence similarities | Contains 5 ANK repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | ANK repeat Repeat |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | positive regulation of transcription from RNA polymerase II promoter Inferred from direct assay PubMed 9857059. Source: MGI transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleus Inferred from direct assay PubMed 9857059. Source: MGI |
| Molecular_function | protein heterodimerization activity Inferred from direct assay PubMed 9857059. Source: MGI sequence-specific DNA binding transcription factor activityTraceable author statement Ref.1. Source: ProtInc transcription regulatory region DNA bindingInferred from direct assay PubMed 9857059. Source: MGI |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| HCFC1 | P51610 | 6 | EBI-618189,EBI-396176 | |
| MAGEB18 | Q96M61 | 3 | EBI-618165,EBI-741835 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q06547-1) Also known as: GABPB-1; Beta-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q06547-2) Also known as: Beta-2; The sequence of this isoform differs from the canonical sequence as follows: 195-206: Missing. | ||||||
| Isoform 3 (identifier: Q06547-3) Also known as: GABPB-2; Gamma-1; The sequence of this isoform differs from the canonical sequence as follows: 346-395: EREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV → VRSLLPGVLCRSHPK | ||||||
| Isoform 4 (identifier: Q06547-4) Also known as: Gamma-2; The sequence of this isoform differs from the canonical sequence as follows: 195-206: Missing. 346-395: EREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV → VRSLLPGVLCRSHPK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 395 | 395 | GA-binding protein subunit beta-1 | PRO_0000066993 | |||||
Regions | |||||||||
| Repeat | 5 – 34 | 30 | ANK 1 | ||||||
| Repeat | 37 – 66 | 30 | ANK 2 | ||||||
| Repeat | 70 – 99 | 30 | ANK 3 | ||||||
| Repeat | 103 – 132 | 30 | ANK 4 | ||||||
| Repeat | 136 – 166 | 31 | ANK 5 | ||||||
| Region | 258 – 327 | 70 | Transcription activation and HCFC1 interaction | ||||||
Natural variations | |||||||||
| Alternative sequence | 195 – 206 | 12 | Missing in isoform 2 and isoform 4. | VSP_000275 | |||||
| Alternative sequence | 346 – 395 | 50 | EREAL…NKEAV → VRSLLPGVLCRSHPK in isoform 3 and isoform 4. | VSP_009337 | |||||
| Natural variant | 31 | 1 | P → A in a colorectal cancer sample; somatic mutation. Ref.12 | VAR_035613 | |||||
Experimental info | |||||||||
| Mutagenesis | 262 – 263 | 2 | QQ → AA: Minor reduction in transcriptional activation; when associated with A-295 or A-305 and A-306. | ||||||
| Mutagenesis | 264 – 265 | 2 | VV → AA: Minor effect upon interaction with HCFC1 and transcriptional activation. Loss of activity; when associated with A-297; A-298 and A-299, or with A-307 and A-310. | ||||||
| Mutagenesis | 270 – 271 | 2 | QQ → AA: Minor reduction in transcriptional activation. Moderate reduction in activity; when associated with A-305 and A-306. | ||||||
| Mutagenesis | 273 – 275 | 3 | ITI → ATA: Strongly reduces interaction with HCFC1 and transcriptional activation. Loss of activity; when associated with A-297; A-298 and A-299, or with A-307 and A-310. Ref.9 | ||||||
| Mutagenesis | 295 | 1 | Q → A: No effect on transcriptional activation. Minor reduction in activity; when associated with A-270 and A-271. Ref.9 | ||||||
| Mutagenesis | 297 – 299 | 3 | IIV → AAA: Strongly reduces interaction with HCFC1 and transcriptional activation. Loss of activity; when associated with A-264 and A-265, or A-273 and A-275. Ref.9 Ref.10 | ||||||
| Mutagenesis | 305 – 306 | 2 | QQ → AA: Minor reduction in transcriptional activation. Moderate reduction in activity; when associated with A-270 and A-271. | ||||||
| Mutagenesis | 307 – 310 | 4 | VLTV → ALTA: Moderately reduces interaction with HCFC1 and transcriptional activation. Loss of activity; when associated with A-273 and A-275. Ref.9 Ref.10 | ||||||
| Sequence conflict | 76 | 1 | H → L AA sequence Ref.7 | ||||||
| Sequence conflict | 246 | 1 | Missing in BAA02573. Ref.1 | ||||||
| Sequence conflict | 274 | 1 | T → A in AAH36080. Ref.6 | ||||||
| Sequence conflict | 341 | 1 | S → C AA sequence Ref.8 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning of transcription factor E4TF1 subunits with Ets and notch motifs." Watanabe H., Sawada J., Yano K., Yamaguchi K., Goto M., Handa H. Mol. Cell. Biol. 13:1385-1391(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "Four structurally distinct, non-DNA-binding subunits of human nuclear respiratory factor 2 share a conserved transcriptional activation domain." Gugneja S., Virbasius J.V., Scarpulla R.C. Mol. Cell. Biol. 15:102-111(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4). Tissue: Testis. |
| [3] | Yang S.J., Li K.N., Zhang Y.Q. Submitted (SEP-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Hepatoma. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Prostate, Testis and Uterus. |
| [7] | "Purification and characterization of nuclear factors binding to the negative regulatory element D of human apolipoprotein A-II promoter: a negative regulatory effect is reversed by GABP, an Ets-related protein." Cardot P., Pastier D., Lacorte J.-M., Mangeney M., Zannis V.I., Chambaz J. Biochemistry 33:12139-12148(1994) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 74-81. |
| [8] | "Identity of GABP with NRF-2, a multisubunit activator of cytochrome oxidase expression, reveals a cellular role for an ETS domain activator of viral promoters." Virbasius J.V., Virbasius C.A., Scarpulla R.C. Genes Dev. 7:380-392(1993) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 105-125 AND 339-385. |
| [9] | "Nuclear respiratory factors 1 and 2 utilize similar glutamine-containing clusters of hydrophobic residues to activate transcription." Gugneja S., Virbasius C.M., Scarpulla R.C. Mol. Cell. Biol. 16:5708-5716(1996) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF 262-GLN-GLN-263; 264-VAL-VAL-265; 270-GLN-GLN-271; 273-ILE--ILE-275; GLN-295; 297-ILE--VAL-299; 305-GLN-GLN-306 AND 307-VAL--VAL-310. |
| [10] | "The novel coactivator C1 (HCF) coordinates multiprotein enhancer formation and mediates transcription activation by GABP." Vogel J.L., Kristie T.M. EMBO J. 19:683-690(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH HCFC1, MUTAGENESIS OF 264-VAL-VAL-265; 273-ILE--ILE-275; 297-ILE--VAL-299 AND 307-VAL--VAL-310. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [12] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] ALA-31. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D13316 mRNA. Translation: BAA02573.1. D13317 mRNA. Translation: BAA02574.1. U13045 mRNA. Translation: AAA65707.1. U13046 mRNA. Translation: AAA65708.1. U13047 mRNA. Translation: AAA65709.1. U13048 mRNA. Translation: AAA65710.1. EU159454 mRNA. Translation: ABV90874.1. BT006652 mRNA. Translation: AAP35298.1. CH471082 Genomic DNA. Translation: EAW77395.1. BC016910 mRNA. Translation: AAH16910.1. BC036080 mRNA. Translation: AAH36080.1. BC050702 mRNA. Translation: AAH50702.1. |
| IPI | IPI00010301. IPI00031516. IPI00218611. IPI00219016. |
| PIR | C48146. I38741. I38743. I38744. |
| RefSeq | NP_002032.2. NM_002041.4. NP_005245.2. NM_005254.5. NP_057738.1. NM_016654.4. NP_057739.1. NM_016655.4. NP_852092.1. NM_181427.3. |
| UniGene | Hs.654350. |
3D structure databases | |
| ProteinModelPortal | Q06547. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q06547. 10 interactions. |
| MINT | MINT-1504045. |
| STRING | 9606.ENSP00000370259. |
PTM databases | |
| PhosphoSite | Q06547. |
Polymorphism databases | |
| DMDM | 23503070. |
Proteomic databases | |
| PaxDb | Q06547. |
| PRIDE | Q06547. |
Protocols and materials databases | |
| DNASU | 2553. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000220429; ENSP00000220429; ENSG00000104064. ENST00000359031; ENSP00000351923; ENSG00000104064. ENST00000380877; ENSP00000370259; ENSG00000104064. ENST00000396464; ENSP00000379728; ENSG00000104064. ENST00000429662; ENSP00000395771; ENSG00000104064. |
| GeneID | 2553. |
| KEGG | hsa:2553. |
| UCSC | uc001zya.3. human. uc001zyb.3. human. uc001zyc.3. human. uc001zye.3. human. |
Organism-specific databases | |
| CTD | 2553. |
| GeneCards | GC15M050569. |
| HGNC | HGNC:4074. GABPB1. |
| HPA | HPA019653. |
| MIM | 600610. gene. |
| neXtProt | NX_Q06547. |
| PharmGKB | PA162389163. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0666. |
| HOVERGEN | HBG051686. |
| InParanoid | Q06547. |
| KO | K09454. |
| OMA | VKRQCIE. |
| OrthoDB | EOG4MCX0P. |
Gene expression databases | |
| ArrayExpress | Q06547. |
| Bgee | Q06547. |
| CleanEx | HS_GABPB1. HS_GABPB2. |
| Genevestigator | Q06547. |
| GermOnline | ENSG00000104064. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.25.40.20. 2 hits. |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. [Graphical view] |
| Pfam | PF00023. Ank. 3 hits. [Graphical view] |
| PRINTS | PR01415. ANKYRIN. |
| SMART | SM00248. ANK. 4 hits. [Graphical view] |
| SUPFAM | SSF48403. ANK. 1 hit. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 2553. |
| NextBio | 10075. |
| SOURCE | Search... |
Entry information
| Entry name | GABP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q06547 Secondary accession number(s): A8IE52 Q8IYD0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
