Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q06455 (MTG8_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 150. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein CBFA2T1
Alternative name(s):
Cyclin-D-related protein
Eight twenty one protein
Protein ETO
Protein MTG8
Zinc finger MYND domain-containing protein 2
Gene names
Name:RUNX1T1
Synonyms:AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length604 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Transcription regulator that excerts its function by binding to histone deacetylases and transcription factors. Can repress transactivation mediated by TCF12. Ref.11 Ref.16

Subunit structure

Homotetramer. Heterotetramer with CBFA2T2 and CBFA2T3. Interacts with TCF12, SIN3A, HDAC1, HDAC2, HDAC3, NCOR1 and NCOR2. Interacts with ATN1 (via its N-terminus); the interaction enhances the transcriptional repression. Ref.11 Ref.12 Ref.15 Ref.16 Ref.17 Ref.18

Subcellular location

Nucleus. Note: Colocalizes with ATN1 in discrete nuclear dots. Ref.11

Tissue specificity

Most abundantly expressed in brain. Lower levels in lung, heart, testis and ovary.

Domain

The TAFH domain mediates interaction with transcription regulators. Ref.18

Involvement in disease

A chromosomal aberration involving RUNX1T1 is a cause of acute myeloid leukemia (AML-M2). Translocation t(8;21)(q22;q22) with RUNX1/AML1. Ref.1 Ref.20 Ref.21 Ref.22

Colorectal cancer (CRC) [MIM:114500]: A complex disease characterized by malignant lesions arising from the inner wall of the large intestine (the colon) and the rectum. Genetic alterations are often associated with progression from premalignant lesion (adenoma) to invasive adenocarcinoma. Risk factors for cancer of the colon and rectum include colon polyps, long-standing ulcerative colitis, and genetic family history.
Note: The disease may be caused by mutations affecting the gene represented in this entry.

Sequence similarities

Belongs to the CBFA2T family.

Contains 1 MYND-type zinc finger.

Contains 1 TAFH (NHR1) domain.

Sequence caution

The sequence AAH05850.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAA03247.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

itself2EBI-743342,EBI-743342
SP1P080472EBI-743342,EBI-298336

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform MTG8B (identifier: Q06455-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform MTG8A (identifier: Q06455-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MISVKRNTWRALSLVIGDCRKKGNFEYCQ → MP
Isoform 3 (identifier: Q06455-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MISVKRNTWRALSLVIGDCRKKGNFEYCQ → MCHPDKAFTSDKLQCVFNEYKAAVWVPPRPRPLSRAPLPE
Isoform 4 (identifier: Q06455-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 604604Protein CBFA2T1
PRO_0000218299

Regions

Domain120 – 21596TAFH
Zinc finger515 – 55137MYND-type
Region337 – 38347Important for oligomerization
Compositional bias57 – 604Poly-Pro
Compositional bias102 – 1087Poly-Ser
Compositional bias290 – 2978Poly-Pro
Compositional bias408 – 4136Poly-Ser

Sites

Site30 – 312Breakpoint for translocation to form AML1-MTG8 in AML-M2

Amino acid modifications

Modified residue411Phosphoserine Ref.14
Modified residue4171Phosphoserine Ref.14

Natural variations

Alternative sequence1 – 3737Missing in isoform 4.
VSP_045442
Alternative sequence1 – 2929MISVK…FEYCQ → MCHPDKAFTSDKLQCVFNEY KAAVWVPPRPRPLSRAPLPE in isoform 3.
VSP_044558
Alternative sequence1 – 2929MISVK…FEYCQ → MP in isoform MTG8A.
VSP_003327
Natural variant3861R → W in a colorectal cancer sample; somatic mutation. Ref.23
VAR_036321
Natural variant3951R → W in a colorectal cancer sample; somatic mutation. Ref.23
VAR_036322
Natural variant4711A → V in a colorectal cancer sample; somatic mutation. Ref.23
VAR_036323

Experimental info

Mutagenesis1251K → A or D: Loss of interaction with TCF12. Ref.16
Mutagenesis1261L → A: Loss of interaction with TCF12. Ref.16
Mutagenesis1281R → D: Loss of interaction with TCF12. Ref.16
Mutagenesis1291F → A: Loss of interaction with TCF12. Ref.16 Ref.18
Mutagenesis1291F → K: Abolishes interaction with corepressor. Ref.16 Ref.18
Mutagenesis1361F → A: Abolishes interaction with corepressor. Ref.18
Mutagenesis1701Q → A: Abolishes interaction with corepressor. Ref.18
Mutagenesis1731T → Q: Abolishes interaction with corepressor. Ref.18
Mutagenesis1751F → A: Abolishes interaction with corepressor. Ref.18
Mutagenesis1771L → A: Abolishes interaction with corepressor. Ref.18
Mutagenesis1781R → A or D: Loss of interaction with TCF12. Ref.16
Mutagenesis1841F → A: Loss of interaction with TCF12. Ref.16
Mutagenesis5471H → A: Causes unfolding of the MYND-type zinc finger domain. Ref.17
Sequence conflict4271D → G in AAC26143. Ref.2
Sequence conflict4551E → G in BAH12630. Ref.3
Sequence conflict5061N → S in BAH12630. Ref.3

Secondary structure

..................................... 604
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform MTG8B [UniParc].

Last modified November 1, 1997. Version 2.
Checksum: C3D2452F96E65679

FASTA60467,566
        10         20         30         40         50         60 
MISVKRNTWR ALSLVIGDCR KKGNFEYCQD RTEKHSTMPD SPVDVKTQSR LTPPTMPPPP 

        70         80         90        100        110        120 
TTQGAPRTSS FTPTTLTNGT SHSPTALNGA PSPPNGFSNG PSSSSSSSLA NQQLPPACGA 

       130        140        150        160        170        180 
RQLSKLKRFL TTLQQFGNDI SPEIGERVRT LVLGLVNSTL TIEEFHSKLQ EATNFPLRPF 

       190        200        210        220        230        240 
VIPFLKANLP LLQRELLHCA RLAKQNPAQY LAQHEQLLLD ASTTSPVDSS ELLLDVNENG 

       250        260        270        280        290        300 
KRRTPDRTKE NGFDREPLHS EHPSKRPCTI SPGQRYSPNN GLSYQPNGLP HPTPPPPQHY 

       310        320        330        340        350        360 
RLDDMAIAHH YRDSYRHPSH RDLRDRNRPM GLHGTRQEEM IDHRLTDREW AEEWKHLDHL 

       370        380        390        400        410        420 
LNCIMDMVEK TRRSLTVLRR CQEADREELN YWIRRYSDAE DLKKGGGSSS SHSRQQSPVN 

       430        440        450        460        470        480 
PDPVALDAHR EFLHRPASGY VPEEIWKKAE EAVNEVKRQA MTELQKAVSE AERKAHDMIT 

       490        500        510        520        530        540 
TERAKMERTV AEAKRQAAED ALAVINQQED SSESCWNCGR KASETCSGCN TARYCGSFCQ 

       550        560        570        580        590        600 
HKDWEKHHHI CGQTLQAQQQ GDTPAVSSSV TPNSGAGSPM DTPPAATPRS TTPGTPSTIE 


TTPR 

« Hide

Isoform MTG8A [UniParc].

Checksum: 70E84F0120C11C3B
Show »

FASTA57764,396
Isoform 3 [UniParc].

Checksum: 4FB11B0FAEC56B07
Show »

FASTA61568,746
Isoform 4 [UniParc].

Checksum: 44AADF2EC7032050
Show »

FASTA56763,212

References

« Hide 'large scale' references
[1]"The t(8;21) translocation in acute myeloid leukemia results in production of an AML1-MTG8 fusion transcript."
Miyoshi H., Kozu T., Shimizu K., Enomoto K., Maseki N., Kaneko Y., Kamada N., Ohki M.
EMBO J. 12:2715-2721(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM MTG8B), VARIANT AML1-MTG8/ETO FUSION IN AML-M2.
Tissue: Fetal brain.
[2]"Structure and expression of the human MTG8/ETO gene."
Wolford J.K., Prochazka M.
Gene 212:103-109(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM MTG8B).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Brain.
[4]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
[5]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MTG8A).
[6]"DNA sequence and analysis of human chromosome 8."
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. expand/collapse author list , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Muscle.
[9]"The ETO portion of acute myeloid leukemia t(8;21) fusion transcript encodes a highly evolutionarily conserved putative transcription factor."
Erickson P.F., Robinson M., Owens G., Drabkin H.A.
Cancer Res. 54:1782-1786(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 31-604.
[10]"Alternative, out-of-frame runt/MTG8 transcripts are encoded by the derivative (8) chromosome in the t(8;21) of acute myeloid leukemia M2."
Tighe J.E., Calabi F.
Blood 84:2115-2121(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 334-432, VARIANT AML1-MTG8/ETO FUSION.
[11]"Atrophin-1, the dentato-rubral and pallido-luysian atrophy gene product, interacts with ETO/MTG8 in the nuclear matrix and represses transcription."
Wood J.D., Nucifora F.C. Jr., Duan K., Zhang C., Wang J., Kim Y., Schilling G., Sacchi N., Liu J.M., Ross C.A.
J. Cell Biol. 150:939-948(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH ATN1, SUBCELLULAR LOCATION, FUNCTION.
[12]"The transcriptional corepressor MTG16a contains a novel nucleolar targeting sequence deranged in t(16; 21)-positive myeloid malignancies."
Hoogeveen A.T., Rossetti S., Stoyanova V., Schonkeren J., Fenaroli A., Schiaffonati L., van Unen L., Sacchi N.
Oncogene 21:6703-6712(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH CBFA2T3.
[13]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[14]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41 AND SER-417, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[15]"The tetramer structure of the Nervy homology two domain, NHR2, is critical for AML1/ETO's activity."
Liu Y., Cheney M.D., Gaudet J.J., Chruszcz M., Lukasik S.M., Sugiyama D., Lary J., Cole J., Dauter Z., Minor W., Speck N.A., Bushweller J.H.
Cancer Cell 9:249-260(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 335-403, SUBUNIT, INTERACTION WITH HDAC1; HDAC2; HDAC3; TCF12; NCOR1; NCOR2; SIN3A; CBFA2T2 AND CBFA2T3.
[16]"The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain."
Plevin M.J., Zhang J., Guo C., Roeder R.G., Ikura M.
Proc. Natl. Acad. Sci. U.S.A. 103:10242-10247(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 120-222, INTERACTION WITH TCF12, FUNCTION, MUTAGENESIS OF LYS-125; LEU-126; ARG-128; PHE-129; ARG-178 AND PHE-184.
[17]"Structural basis for recognition of SMRT/N-CoR by the MYND domain and its contribution to AML1/ETO's activity."
Liu Y., Chen W., Gaudet J., Cheney M.D., Roudaia L., Cierpicki T., Klet R.C., Hartman K., Laue T.M., Speck N.A., Bushweller J.H.
Cancer Cell 11:483-497(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 510-559 IN COMPLEX WITH ZINC IONS AND NCOR2, MUTAGENESIS OF HIS-547, INTERACTION WITH NCOR1 AND NCOR2.
[18]"A TAF4-homology domain from the corepressor ETO is a docking platform for positive and negative regulators of transcription."
Wei Y., Liu S., Lausen J., Woodrell C., Cho S., Biris N., Kobayashi N., Wei Y., Yokoyama S., Werner M.H.
Nat. Struct. Mol. Biol. 14:653-661(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 119-225, INTERACTION WITH NCOR1 AND TCF12, MUTAGENESIS OF PHE-129; PHE-136; GLN-170; THR-173; PHE-175 AND LEU-177, DOMAIN.
[19]"Solution structure of ZF-MYND domain of protein CBFA2TI (protein MTG8)."
RIKEN structural genomics initiative (RSGI)
Submitted (OCT-2006) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 505-551.
[20]"Identification of two transcripts of AML1/ETO-fused gene in t(8;21) leukemic cells and expression of wild-type ETO gene in hematopoietic cells."
Era T., Asou N., Kunisada T., Yamasaki H., Asou H., Kamada N., Nishikawa S., Yamaguchi K., Takatsuki K.
Genes Chromosomes Cancer 13:25-33(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT AML1-MTG8/ETO FUSION IN AML-M2.
[21]"Junctions of the AML1/MTG8(ETO) fusion are constant in t(8;21) acute myeloid leukemia detected by reverse transcription polymerase chain reaction."
Kozu T., Miyoshi H., Shimizu K., Maseki N., Kaneko Y., Asou H., Kamada N., Ohki M.
Blood 82:1270-1276(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT AML1-MTG8/ETO FUSION IN AML-M2.
[22]"Transcriptionally active chimeric gene derived from the fusion of the AML1 gene and a novel gene on chromosome 8 in t(8;21) leukemic cells."
Nisson P.E., Watkins P.C., Sacchi N.
Cancer Genet. Cytogenet. 63:81-88(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT AML1-MTG8/ETO FUSION IN AML-M2.
[23]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS [LARGE SCALE ANALYSIS] TRP-386; TRP-395 AND VAL-471.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D14821 mRNA. Translation: BAA03558.1.
D13979 mRNA. Translation: BAA03089.1. Sequence problems.
D14289 mRNA. Translation: BAA03247.1. Different initiation.
AF018282 expand/collapse EMBL AC list , AF018271, AF018272, AF018273, AF018274, AF018275, AF018276, AF018277, AF018278, AF018279, AF018281 Genomic DNA. Translation: AAC28932.1.
AF018282 expand/collapse EMBL AC list , AF018270, AF018272, AF018273, AF018274, AF018275, AF018276, AF018277, AF018278, AF018279, AF018281 Genomic DNA. Translation: AAC28931.1.
AF018283 mRNA. Translation: AAC26143.1.
AK297616 mRNA. Translation: BAH12630.1.
BT009871 mRNA. Translation: AAP88873.1.
CR456792 mRNA. Translation: CAG33073.1.
AC103680 Genomic DNA. No translation available.
AC104339 Genomic DNA. No translation available.
CH471060 Genomic DNA. Translation: EAW91685.1.
BC005850 mRNA. Translation: AAH05850.1. Different initiation.
BC067078 mRNA. Translation: AAH67078.2.
AF181450 Genomic DNA. No translation available.
D43638 mRNA. Translation: BAA07755.1.
X79990 mRNA. Translation: CAA56311.1.
S74096 Genomic DNA. Translation: AAB32126.1.
S74092 Genomic DNA. No translation available.
S78158 mRNA. Translation: AAB34819.2. Sequence problems.
S78159 mRNA. Translation: AAB34820.2. Sequence problems.
D14822 mRNA. Translation: BAA03559.1. Sequence problems.
D14823 mRNA. Translation: BAA03560.1. Sequence problems.
S50186 Genomic DNA. No translation available.
PIRA57784.
C57784.
RefSeqNP_001185554.1. NM_001198625.1.
NP_001185555.1. NM_001198626.1.
NP_001185556.1. NM_001198627.1.
NP_001185557.1. NM_001198628.1.
NP_001185558.1. NM_001198629.1.
NP_001185559.1. NM_001198630.1.
NP_001185560.1. NM_001198631.1.
NP_001185561.1. NM_001198632.1.
NP_001185562.1. NM_001198633.1.
NP_001185563.1. NM_001198634.1.
NP_001185608.1. NM_001198679.1.
NP_004340.1. NM_004349.3.
NP_783552.1. NM_175634.2.
NP_783553.1. NM_175635.2.
NP_783554.1. NM_175636.2.
UniGeneHs.368431.
Hs.739194.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1WQ6X-ray2.00A/B335-403[»]
2DJ8NMR-A505-551[»]
2H7BNMR-A120-222[»]
2KNHNMR-A119-216[»]
2KYGNMR-C437-467[»]
2OD1NMR-A510-559[»]
2ODDNMR-A510-559[»]
2PP4NMR-A119-225[»]
4JOLX-ray2.91A/B/C/D338-400[»]
ProteinModelPortalQ06455.
SMRQ06455. Positions 119-216, 341-400, 437-467, 510-559.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107310. 41 interactions.
DIPDIP-29401N.
IntActQ06455. 12 interactions.
MINTMINT-1439547.

PTM databases

PhosphoSiteQ06455.

Polymorphism databases

DMDM2498595.

Proteomic databases

PaxDbQ06455.
PRIDEQ06455.

Protocols and materials databases

DNASU862.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000265814; ENSP00000265814; ENSG00000079102. [Q06455-1]
ENST00000360348; ENSP00000353504; ENSG00000079102. [Q06455-4]
ENST00000396218; ENSP00000379520; ENSG00000079102. [Q06455-2]
ENST00000422361; ENSP00000390137; ENSG00000079102. [Q06455-4]
ENST00000436581; ENSP00000402257; ENSG00000079102. [Q06455-3]
ENST00000518844; ENSP00000430728; ENSG00000079102. [Q06455-2]
ENST00000520724; ENSP00000428742; ENSG00000079102. [Q06455-4]
ENST00000523629; ENSP00000428543; ENSG00000079102. [Q06455-1]
GeneID862.
KEGGhsa:862.
UCSCuc003yfb.2. human. [Q06455-1]
uc003yfc.2. human. [Q06455-2]

Organism-specific databases

CTD862.
GeneCardsGC08M092971.
HGNCHGNC:1535. RUNX1T1.
MIM114500. phenotype.
133435. gene.
neXtProtNX_Q06455.
Orphanet102724. Acute myeloid leukemia with t(8;21)(q22;q22) translocation.
PharmGKBPA26111.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG79810.
HOVERGENHBG000169.
KOK10053.
OMADMITSER.
OrthoDBEOG70W3D2.
PhylomeDBQ06455.
TreeFamTF106303.

Gene expression databases

ArrayExpressQ06455.
BgeeQ06455.
GenevestigatorQ06455.

Family and domain databases

InterProIPR013289. ETO.
IPR013290. MTG8.
IPR014896. NHR2.
IPR003894. TAFH_NHR1.
IPR002893. Znf_MYND.
[Graphical view]
PANTHERPTHR10379:SF5. PTHR10379:SF5. 1 hit.
PfamPF08788. NHR2. 1 hit.
PF07531. TAFH. 1 hit.
PF01753. zf-MYND. 1 hit.
[Graphical view]
PRINTSPR01875. ETOFAMILY.
PR01876. MTG8PROTEIN.
SMARTSM00549. TAFH. 1 hit.
[Graphical view]
PROSITEPS51119. TAFH. 1 hit.
PS01360. ZF_MYND_1. 1 hit.
PS50865. ZF_MYND_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSRUNX1T1. human.
EvolutionaryTraceQ06455.
GeneWikiRUNX1T1.
GenomeRNAi862.
NextBio3586.
PROQ06455.
SOURCESearch...

Entry information

Entry nameMTG8_HUMAN
AccessionPrimary (citable) accession number: Q06455
Secondary accession number(s): B7Z4P4 expand/collapse secondary AC list , E7EPN4, O14784, Q06456, Q14873, Q16239, Q16346, Q16347, Q6IBL1, Q6NXH1, Q7Z4J5, Q92479, Q9BRZ0
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: April 16, 2014
This is version 150 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM