Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q06413

- MEF2C_HUMAN

UniProt

Q06413 - MEF2C_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Myocyte-specific enhancer factor 2C

Gene

MEF2C

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B-lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B-cells. May also be involved in neurogenesis and in the development of cortical architecture (By similarity). Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isoform 2.By similarity6 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei432 – 4332CleavageCurated

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi58 – 8629Mef2-typeSequence AnalysisAdd
BLAST

GO - Molecular functioni

  1. activating transcription factor binding Source: UniProtKB
  2. AT DNA binding Source: UniProtKB
  3. chromatin binding Source: Ensembl
  4. core promoter sequence-specific DNA binding Source: Ensembl
  5. DNA binding Source: UniProtKB
  6. miRNA binding Source: UniProtKB
  7. protein heterodimerization activity Source: UniProtKB
  8. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: Ensembl
  9. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: UniProtKB
  10. RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity Source: UniProtKB
  11. RNA polymerase II distal enhancer sequence-specific DNA binding Source: Ensembl
  12. RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: Ensembl
  13. RNA polymerase II regulatory region sequence-specific DNA binding Source: UniProtKB
  14. sequence-specific DNA binding RNA polymerase II transcription factor activity Source: UniProtKB
  15. sequence-specific DNA binding transcription factor activity Source: BHF-UCL
  16. transcription regulatory region DNA binding Source: BHF-UCL

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
  2. B cell homeostasis Source: UniProtKB
  3. B cell proliferation Source: UniProtKB
  4. B cell receptor signaling pathway Source: UniProtKB
  5. blood vessel development Source: UniProtKB
  6. blood vessel remodeling Source: UniProtKB
  7. cardiac muscle hypertrophy in response to stress Source: Ensembl
  8. cardiac ventricle formation Source: UniProtKB
  9. cartilage morphogenesis Source: Ensembl
  10. cell morphogenesis involved in neuron differentiation Source: Alzheimers_University_of_Toronto
  11. cellular response to calcium ion Source: UniProtKB
  12. cellular response to drug Source: UniProtKB
  13. cellular response to fluid shear stress Source: UniProtKB
  14. cellular response to glucose stimulus Source: Ensembl
  15. cellular response to lipopolysaccharide Source: UniProtKB
  16. cellular response to parathyroid hormone stimulus Source: UniProtKB
  17. cellular response to retinoic acid Source: Ensembl
  18. cellular response to transforming growth factor beta stimulus Source: UniProtKB
  19. cellular response to trichostatin A Source: UniProtKB
  20. chondrocyte differentiation Source: UniProtKB
  21. dentate gyrus development Source: Ensembl
  22. embryonic viscerocranium morphogenesis Source: Ensembl
  23. endochondral ossification Source: UniProtKB
  24. epithelial cell proliferation involved in renal tubule morphogenesis Source: UniProtKB
  25. germinal center formation Source: UniProtKB
  26. glomerulus morphogenesis Source: UniProtKB
  27. heart development Source: UniProtKB
  28. heart looping Source: UniProtKB
  29. humoral immune response Source: UniProtKB
  30. innate immune response Source: Reactome
  31. learning or memory Source: UniProtKB
  32. MAPK cascade Source: UniProtKB
  33. melanocyte differentiation Source: UniProtKB
  34. monocyte differentiation Source: Ensembl
  35. muscle cell differentiation Source: Reactome
  36. muscle cell fate determination Source: UniProtKB
  37. muscle organ development Source: ProtInc
  38. MyD88-dependent toll-like receptor signaling pathway Source: Reactome
  39. MyD88-independent toll-like receptor signaling pathway Source: Reactome
  40. myotube differentiation Source: UniProtKB
  41. negative regulation of epithelial cell proliferation Source: Ensembl
  42. negative regulation of gene expression Source: UniProtKB
  43. negative regulation of neuron apoptotic process Source: UniProtKB
  44. negative regulation of ossification Source: UniProtKB
  45. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  46. nephron tubule epithelial cell differentiation Source: UniProtKB
  47. nervous system development Source: ProtInc
  48. neural crest cell differentiation Source: UniProtKB
  49. neuron development Source: UniProtKB
  50. neuron differentiation Source: UniProtKB
  51. neuron migration Source: Alzheimers_University_of_Toronto
  52. neurotrophin TRK receptor signaling pathway Source: Reactome
  53. osteoblast differentiation Source: UniProtKB
  54. outflow tract morphogenesis Source: UniProtKB
  55. palate development Source: Ensembl
  56. platelet formation Source: UniProtKB
  57. positive regulation of alkaline phosphatase activity Source: UniProtKB
  58. positive regulation of B cell proliferation Source: UniProtKB
  59. positive regulation of behavioral fear response Source: UniProtKB
  60. positive regulation of bone mineralization Source: UniProtKB
  61. positive regulation of cardiac muscle cell differentiation Source: UniProtKB
  62. positive regulation of cardiac muscle cell proliferation Source: UniProtKB
  63. positive regulation of cardiac muscle hypertrophy Source: Ensembl
  64. positive regulation of cell proliferation in bone marrow Source: Ensembl
  65. positive regulation of gene expression Source: UniProtKB
  66. positive regulation of macrophage apoptotic process Source: UniProtKB
  67. positive regulation of MAP kinase activity Source: Alzheimers_University_of_Toronto
  68. positive regulation of muscle cell differentiation Source: Reactome
  69. positive regulation of myoblast differentiation Source: UniProtKB
  70. positive regulation of neuron differentiation Source: UniProtKB
  71. positive regulation of osteoblast differentiation Source: UniProtKB
  72. positive regulation of protein homodimerization activity Source: UniProtKB
  73. positive regulation of skeletal muscle cell differentiation Source: UniProtKB
  74. positive regulation of skeletal muscle tissue development Source: UniProtKB
  75. positive regulation of transcription, DNA-templated Source: UniProtKB
  76. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  77. primary heart field specification Source: UniProtKB
  78. regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity Source: Alzheimers_University_of_Toronto
  79. regulation of dendritic spine development Source: Alzheimers_University_of_Toronto
  80. regulation of excitatory postsynaptic membrane potential Source: Alzheimers_University_of_Toronto
  81. regulation of germinal center formation Source: UniProtKB
  82. regulation of megakaryocyte differentiation Source: UniProtKB
  83. regulation of neuron apoptotic process Source: Alzheimers_University_of_Toronto
  84. regulation of neurotransmitter secretion Source: Alzheimers_University_of_Toronto
  85. regulation of N-methyl-D-aspartate selective glutamate receptor activity Source: Alzheimers_University_of_Toronto
  86. regulation of sarcomere organization Source: Ensembl
  87. regulation of synapse assembly Source: Alzheimers_University_of_Toronto
  88. regulation of synaptic activity Source: UniProtKB
  89. regulation of synaptic plasticity Source: Alzheimers_University_of_Toronto
  90. regulation of synaptic transmission, glutamatergic Source: Alzheimers_University_of_Toronto
  91. regulation of transcription, DNA-templated Source: Alzheimers_University_of_Toronto
  92. renal tubule morphogenesis Source: UniProtKB
  93. response to ischemia Source: Alzheimers_University_of_Toronto
  94. response to virus Source: UniProtKB
  95. response to vitamin E Source: Ensembl
  96. secondary heart field specification Source: UniProtKB
  97. sinoatrial valve morphogenesis Source: UniProtKB
  98. skeletal muscle tissue development Source: UniProtKB
  99. smooth muscle cell differentiation Source: UniProtKB
  100. stress-activated MAPK cascade Source: Reactome
  101. toll-like receptor 10 signaling pathway Source: Reactome
  102. toll-like receptor 2 signaling pathway Source: Reactome
  103. toll-like receptor 3 signaling pathway Source: Reactome
  104. toll-like receptor 4 signaling pathway Source: Reactome
  105. toll-like receptor 5 signaling pathway Source: Reactome
  106. toll-like receptor 9 signaling pathway Source: Reactome
  107. toll-like receptor signaling pathway Source: Reactome
  108. toll-like receptor TLR1:TLR2 signaling pathway Source: Reactome
  109. toll-like receptor TLR6:TLR2 signaling pathway Source: Reactome
  110. TRIF-dependent toll-like receptor signaling pathway Source: Reactome
  111. ventricular cardiac muscle cell differentiation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Activator, Developmental protein

Keywords - Biological processi

Apoptosis, Differentiation, Neurogenesis, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiREACT_12599. ERK/MAPK targets.
REACT_200608. Transcriptional activation of mitochondrial biogenesis.
REACT_21402. CDO in myogenesis.
REACT_24941. Circadian Clock.
SignaLinkiQ06413.

Names & Taxonomyi

Protein namesi
Recommended name:
Myocyte-specific enhancer factor 2C
Gene namesi
Name:MEF2C
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:6996. MEF2C.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. cytosol Source: Alzheimers_University_of_Toronto
  3. nuclear speck Source: BHF-UCL
  4. nucleoplasm Source: Reactome
  5. nucleus Source: UniProtKB
  6. protein complex Source: UniProtKB
  7. sarcomere Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Mental retardation, autosomal dominant 20 (MRD20) [MIM:613443]: A disorder characterized by severe mental retardation, absent speech, hypotonia, poor eye contact and stereotypic movements. Dysmorphic features include high broad forehead with variable small chin, short nose with anteverted nares, large open mouth, upslanted palpebral fissures and prominent eyebrows. Some patients have seizures.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi116 – 1161K → R: Reduced acetylation. Further reduction in acetylation; when associated with R-119. Complete loss of acetylation, 15% less transactivation activity and slightly reduced DNA binding; when associated with R-119; R-234; R-239; R-252 and R-262. 1 Publication
Mutagenesisi119 – 1191K → R: Reduced acetylation. Further reduction in acetylation; when associated with R-119. Complete loss of acetylation, 15% less transactivation activity and slightly reduced DNA binding; when associated with R-116; R-234; R-239; R-252 and R-262. 1 Publication
Mutagenesisi234 – 2341K → R: Reduced acetylation. Complete loss of acetylation, 15% less transactivation activity and slightly reduced DNA binding; when associated with R-116; R-119; R-239; R-252 and R-264. 1 Publication
Mutagenesisi239 – 2391K → R: Reduced acetylation. Complete loss of acetylation, 15% less transactivation activity and slightly reduced DNA binding; when associated with R-116; R-119; R-234; R-252 and R-264. 1 Publication
Mutagenesisi252 – 2521K → R: Reduced acetylation. Complete loss of acetylation, 15% less transactivation activity and slightly reduced DNA binding; when associated with R-116; R-119; R-234; R-239 and R-264. 1 Publication
Mutagenesisi264 – 2641K → R: Reduced acetylation. Complete loss of acetylation, 15% less transactivation activity and slightly reduced DNA binding; when associated with R-116; R-119; R-234; R-239 and R-252. 1 Publication
Mutagenesisi271 – 2711S → A: No effect on transcriptional activation. 1 Publication
Mutagenesisi272 – 2721E → Q: Reduced transcriptional activation. Completely abolishes transcriptional activation; when associated with N-273 and N-275. 1 Publication
Mutagenesisi273 – 2731D → N: Reduced transcriptional activation. Completely abolishes transcriptional activation; when associated with Q-272 and N-275. 1 Publication
Mutagenesisi275 – 2751D → N: Reduced transcriptional activation. Completely abolishes transcriptional activation; when associated with Q-272 and N-273. 1 Publication
Mutagenesisi293 – 2931T → A: Abolishes MAPK14-mediated phosphorylation. No effect on MAPK7-mediated phosphorylation; when associated with A-300. 2 Publications
Mutagenesisi300 – 3001T → A: Abolishes MAPK14-mediated phosphorylation. No effect on MAPK7-mediated phosphorylation; when associated with A-293. 2 Publications
Mutagenesisi387 – 3871S → A: No change in transactivational activation for isoforms with or without the beta domain. 1 Publication
Mutagenesisi391 – 3911K → R: Abolishes sumoylation. 1 Publication
Mutagenesisi396 – 3961S → A or C: Abolishes sumoylation. Enhanced transcriptional activity. 3 Publications
Mutagenesisi396 – 3961S → A: No change in transactivational activation for isoforms with or without the beta domain. 3 Publications
Mutagenesisi396 – 3961S → E: No effect on sumoylation. No effect on transcriptional activity. 3 Publications
Mutagenesisi419 – 4191S → A: No effect on MAPK14-mediated phosphorylation. Abolishes MAPK7-mediated phosphorylation and reduces transactivation activity. 2 Publications
Mutagenesisi432 – 4321D → A: Abolishes cleavage by caspase 7. 1 Publication

Keywords - Diseasei

Epilepsy, Mental retardation

Organism-specific databases

MIMi613443. phenotype.
Orphaneti228384. 5q14.3 microdeletion syndrome.
PharmGKBiPA30734.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 473473Myocyte-specific enhancer factor 2CPRO_0000199433Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei4 – 41N6-acetyllysineBy similarity
Modified residuei59 – 591Phosphoserine; by CK2By similarity
Modified residuei116 – 1161N6-acetyllysine1 Publication
Modified residuei119 – 1191N6-acetyllysine1 Publication
Modified residuei234 – 2341N6-acetyllysine1 Publication
Modified residuei239 – 2391N6-acetyllysine1 Publication
Modified residuei252 – 2521N6-acetyllysine1 Publication
Modified residuei264 – 2641N6-acetyllysine1 Publication
Modified residuei293 – 2931Phosphothreonine; by MAPK142 Publications
Modified residuei300 – 3001Phosphothreonine; by MAPK142 Publications
Cross-linki391 – 391Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
Modified residuei396 – 3961Phosphoserine; by CDK51 Publication
Modified residuei419 – 4191Phosphoserine; by MAPK72 Publications

Post-translational modificationi

Phosphorylation on Ser-59 enhances DNA binding activity (By similarity). Phosphorylation on Ser-396 is required for Lys-391 sumoylation and inhibits transcriptional activity.By similarity7 Publications
Acetylated by p300 on several sites in diffentiating myocytes. Acetylation on Lys-4 increases DNA binding and transactivation (By similarity).By similarity
Sumoylated on Lys-391 with SUMO2 but not by SUMO1 represses transcriptional activity.3 Publications
Proteolytically cleaved in cerebellar granule neurons, probably by caspase 7, following neurotoxicity. Preferentially cleaves the CDK5-mediated hyperphosphorylated form which leads to neuron apoptosis and transcriptional inactivation.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ06413.
PaxDbiQ06413.
PRIDEiQ06413.

PTM databases

PhosphoSiteiQ06413.

Expressioni

Tissue specificityi

Expressed in brain and skeletal muscle.1 Publication

Developmental stagei

Expression is highest during the early stages of postnatal development, at later stages levels greatly decrease.

Gene expression databases

BgeeiQ06413.
CleanExiHS_MEF2C.
ExpressionAtlasiQ06413. baseline and differential.
GenevestigatoriQ06413.

Organism-specific databases

HPAiHPA005533.

Interactioni

Subunit structurei

Forms a complex with class II HDACs in undifferentiating cells. On myogenic differentiation, HDACs are released into the cytoplasm allowing MEF2s to interact with other proteins for activation. Interacts with EP300 in differentiating cells; the interaction acetylates MEF2C leading to increased DNA binding and activation. Interacts with HDAC7 and CARM1 (By similarity). Interacts with HDAC4, HDAC7 AND HDAC9; the interaction WITH HDACs represses transcriptional activity. Interacts with MYOCD (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
MYLK2Q9H1R32EBI-2684075,EBI-356910

Protein-protein interaction databases

BioGridi110372. 26 interactions.
DIPiDIP-40857N.
IntActiQ06413. 16 interactions.
MINTiMINT-125556.
STRINGi9606.ENSP00000396219.

Structurei

3D structure databases

ProteinModelPortaliQ06413.
SMRiQ06413. Positions 2-73.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini3 – 5755MADS-boxPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni271 – 2788Beta domain
Regioni368 – 39932Transcription repressorAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi4 – 3128Lys-rich (basic)Add
BLAST
Compositional biasi146 – 18338Ser-richAdd
BLAST

Domaini

The beta domain, missing in a number of isoforms, is required for enhancement of transcriptional activity.By similarity

Sequence similaritiesi

Belongs to the MEF2 family.Curated
Contains 1 MADS-box domain.PROSITE-ProRule annotation
Contains 1 Mef2-type DNA-binding domain.Curated

Phylogenomic databases

eggNOGiCOG5068.
GeneTreeiENSGT00390000011828.
HOGENOMiHOG000230620.
HOVERGENiHBG053944.
InParanoidiQ06413.
KOiK04454.
OMAiMQHSALS.
OrthoDBiEOG793B7D.
PhylomeDBiQ06413.
TreeFamiTF314067.

Family and domain databases

InterProiIPR022102. HJURP_C.
IPR002100. TF_MADSbox.
[Graphical view]
PfamiPF12347. HJURP_C. 1 hit.
PF00319. SRF-TF. 1 hit.
[Graphical view]
PRINTSiPR00404. MADSDOMAIN.
SMARTiSM00432. MADS. 1 hit.
[Graphical view]
SUPFAMiSSF55455. SSF55455. 1 hit.
PROSITEiPS00350. MADS_BOX_1. 1 hit.
PS50066. MADS_BOX_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q06413-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGRKKIQITR IMDERNRQVT FTKRKFGLMK KAYELSVLCD CEIALIIFNS
60 70 80 90 100
TNKLFQYAST DMDKVLLKYT EYNEPHESRT NSDIVETLRK KGLNGCDSPD
110 120 130 140 150
PDADDSVGHS PESEDKYRKI NEDIDLMISR QRLCAVPPPN FEMPVSIPVS
160 170 180 190 200
SHNSLVYSNP VSSLGNPNLL PLAHPSLQRN SMSPGVTHRP PSAGNTGGLM
210 220 230 240 250
GGDLTSGAGT SAGNGYGNPR NSPGLLVSPG NLNKNMQAKS PPPMNLGMNN
260 270 280 290 300
RKPDLRVLIP PGSKNTMPSV SEDVDLLLNQ RINNSQSAQS LATPVVSVAT
310 320 330 340 350
PTLPGQGMGG YPSAISTTYG TEYSLSSADL SSLSGFNTAS ALHLGSVTGW
360 370 380 390 400
QQQHLHNMPP SALSQLGACT STHLSQSSNL SLPSTQSLNI KSEPVSPPRD
410 420 430 440 450
RTTTPSRYPQ HTRHEAGRSP VDSLSSCSSS YDGSDREDHR NEFHSPIGLT
460 470
RPSPDERESP SVKRMRLSEG WAT
Length:473
Mass (Da):51,221
Last modified:November 1, 1997 - v1
Checksum:iA7982020BB8C8949
GO
Isoform 2 (identifier: Q06413-2) [UniParc]FASTAAdd to Basket

Also known as: Muscle

The sequence of this isoform differs from the canonical sequence as follows:
     271-278: Missing.

Show »
Length:465
Mass (Da):50,336
Checksum:iA2059C6AACB2F07B
GO
Isoform 3 (identifier: Q06413-3) [UniParc]FASTAAdd to Basket

Also known as: hMEF2C-delta32, Brain

The sequence of this isoform differs from the canonical sequence as follows:
     368-399: Missing.

Show »
Length:441
Mass (Da):47,872
Checksum:iBF94FD79A54FEEB1
GO
Isoform 4 (identifier: Q06413-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-134: Missing.
     271-278: Missing.

Show »
Length:417
Mass (Da):44,935
Checksum:i35B8B495FAB6FA3C
GO
Isoform 5 (identifier: Q06413-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     107-134: VGHSPESEDKYRKINEDIDLMISRQRLC → ALNKKENKGCESPDPDSSYALTPRTEEKYKKINEEFDNMIKSHKIP
     271-278: Missing.

Note: No experimental confirmation available.

Show »
Length:483
Mass (Da):52,328
Checksum:i54ECDC4D04211C48
GO
Isoform 6 (identifier: Q06413-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-134: TLRKKGLNGC...DLMISRQRLC → ALNKKENKGC...DNMIKSHKIP
     271-278: Missing.

Note: No experimental confirmation available.

Show »
Length:463
Mass (Da):50,242
Checksum:iB78282622DC98CE5
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti390 – 3901I → T in AL833268. (PubMed:17974005)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei87 – 13448Missing in isoform 4. 1 PublicationVSP_043339Add
BLAST
Alternative sequencei87 – 13448TLRKK…RQRLC → ALNKKENKGCESPDPDSSYA LTPRTEEKYKKINEEFDNMI KSHKIP in isoform 6. 1 PublicationVSP_046251Add
BLAST
Alternative sequencei107 – 13428VGHSP…RQRLC → ALNKKENKGCESPDPDSSYA LTPRTEEKYKKINEEFDNMI KSHKIP in isoform 5. 1 PublicationVSP_045478Add
BLAST
Alternative sequencei271 – 2788Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 4 PublicationsVSP_006248
Alternative sequencei368 – 39932Missing in isoform 3. 1 PublicationVSP_006249Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L08895 mRNA. Translation: AAA59578.1.
S57212 mRNA. Translation: AAB25838.1.
FM163484 mRNA. Translation: CAQ57795.2.
AL833268 mRNA. No translation available.
AL833274 mRNA. No translation available.
AC008525 Genomic DNA. No translation available.
AC008835 Genomic DNA. No translation available.
CCDSiCCDS47244.1. [Q06413-6]
CCDS47245.1. [Q06413-1]
CCDS54877.1. [Q06413-4]
CCDS54878.1. [Q06413-5]
PIRiA47284.
RefSeqiNP_001124477.1. NM_001131005.2. [Q06413-6]
NP_001180276.1. NM_001193347.1. [Q06413-5]
NP_001180277.1. NM_001193348.1. [Q06413-4]
NP_001180278.1. NM_001193349.1.
NP_001180279.1. NM_001193350.1. [Q06413-1]
NP_002388.2. NM_002397.4. [Q06413-1]
XP_005248568.1. XM_005248511.1. [Q06413-1]
XP_006714681.1. XM_006714618.1. [Q06413-1]
XP_006714682.1. XM_006714619.1. [Q06413-1]
XP_006714684.1. XM_006714621.1. [Q06413-2]
XP_006714685.1. XM_006714622.1. [Q06413-6]
XP_006714686.1. XM_006714623.1. [Q06413-3]
XP_006714688.1. XM_006714625.1. [Q06413-5]
UniGeneiHs.649965.

Genome annotation databases

EnsembliENST00000340208; ENSP00000340874; ENSG00000081189. [Q06413-5]
ENST00000424173; ENSP00000389610; ENSG00000081189. [Q06413-6]
ENST00000437473; ENSP00000396219; ENSG00000081189. [Q06413-1]
ENST00000504921; ENSP00000421925; ENSG00000081189. [Q06413-4]
ENST00000510942; ENSP00000422390; ENSG00000081189. [Q06413-2]
ENST00000514015; ENSP00000424606; ENSG00000081189. [Q06413-3]
ENST00000514028; ENSP00000426665; ENSG00000081189. [Q06413-1]
GeneIDi4208.
KEGGihsa:4208.
UCSCiuc003kji.2. human. [Q06413-2]
uc003kjj.3. human. [Q06413-1]
uc021ybh.1. human. [Q06413-4]

Polymorphism databases

DMDMi2500875.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L08895 mRNA. Translation: AAA59578.1 .
S57212 mRNA. Translation: AAB25838.1 .
FM163484 mRNA. Translation: CAQ57795.2 .
AL833268 mRNA. No translation available.
AL833274 mRNA. No translation available.
AC008525 Genomic DNA. No translation available.
AC008835 Genomic DNA. No translation available.
CCDSi CCDS47244.1. [Q06413-6 ]
CCDS47245.1. [Q06413-1 ]
CCDS54877.1. [Q06413-4 ]
CCDS54878.1. [Q06413-5 ]
PIRi A47284.
RefSeqi NP_001124477.1. NM_001131005.2. [Q06413-6 ]
NP_001180276.1. NM_001193347.1. [Q06413-5 ]
NP_001180277.1. NM_001193348.1. [Q06413-4 ]
NP_001180278.1. NM_001193349.1.
NP_001180279.1. NM_001193350.1. [Q06413-1 ]
NP_002388.2. NM_002397.4. [Q06413-1 ]
XP_005248568.1. XM_005248511.1. [Q06413-1 ]
XP_006714681.1. XM_006714618.1. [Q06413-1 ]
XP_006714682.1. XM_006714619.1. [Q06413-1 ]
XP_006714684.1. XM_006714621.1. [Q06413-2 ]
XP_006714685.1. XM_006714622.1. [Q06413-6 ]
XP_006714686.1. XM_006714623.1. [Q06413-3 ]
XP_006714688.1. XM_006714625.1. [Q06413-5 ]
UniGenei Hs.649965.

3D structure databases

ProteinModelPortali Q06413.
SMRi Q06413. Positions 2-73.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110372. 26 interactions.
DIPi DIP-40857N.
IntActi Q06413. 16 interactions.
MINTi MINT-125556.
STRINGi 9606.ENSP00000396219.

PTM databases

PhosphoSitei Q06413.

Polymorphism databases

DMDMi 2500875.

Proteomic databases

MaxQBi Q06413.
PaxDbi Q06413.
PRIDEi Q06413.

Protocols and materials databases

DNASUi 4208.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000340208 ; ENSP00000340874 ; ENSG00000081189 . [Q06413-5 ]
ENST00000424173 ; ENSP00000389610 ; ENSG00000081189 . [Q06413-6 ]
ENST00000437473 ; ENSP00000396219 ; ENSG00000081189 . [Q06413-1 ]
ENST00000504921 ; ENSP00000421925 ; ENSG00000081189 . [Q06413-4 ]
ENST00000510942 ; ENSP00000422390 ; ENSG00000081189 . [Q06413-2 ]
ENST00000514015 ; ENSP00000424606 ; ENSG00000081189 . [Q06413-3 ]
ENST00000514028 ; ENSP00000426665 ; ENSG00000081189 . [Q06413-1 ]
GeneIDi 4208.
KEGGi hsa:4208.
UCSCi uc003kji.2. human. [Q06413-2 ]
uc003kjj.3. human. [Q06413-1 ]
uc021ybh.1. human. [Q06413-4 ]

Organism-specific databases

CTDi 4208.
GeneCardsi GC05M088013.
HGNCi HGNC:6996. MEF2C.
HPAi HPA005533.
MIMi 600662. gene.
613443. phenotype.
neXtProti NX_Q06413.
Orphaneti 228384. 5q14.3 microdeletion syndrome.
PharmGKBi PA30734.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5068.
GeneTreei ENSGT00390000011828.
HOGENOMi HOG000230620.
HOVERGENi HBG053944.
InParanoidi Q06413.
KOi K04454.
OMAi MQHSALS.
OrthoDBi EOG793B7D.
PhylomeDBi Q06413.
TreeFami TF314067.

Enzyme and pathway databases

Reactomei REACT_12599. ERK/MAPK targets.
REACT_200608. Transcriptional activation of mitochondrial biogenesis.
REACT_21402. CDO in myogenesis.
REACT_24941. Circadian Clock.
SignaLinki Q06413.

Miscellaneous databases

ChiTaRSi MEF2C. human.
GeneWikii MEF2C.
GenomeRNAii 4208.
NextBioi 16578.
PROi Q06413.
SOURCEi Search...

Gene expression databases

Bgeei Q06413.
CleanExi HS_MEF2C.
ExpressionAtlasi Q06413. baseline and differential.
Genevestigatori Q06413.

Family and domain databases

InterProi IPR022102. HJURP_C.
IPR002100. TF_MADSbox.
[Graphical view ]
Pfami PF12347. HJURP_C. 1 hit.
PF00319. SRF-TF. 1 hit.
[Graphical view ]
PRINTSi PR00404. MADSDOMAIN.
SMARTi SM00432. MADS. 1 hit.
[Graphical view ]
SUPFAMi SSF55455. SSF55455. 1 hit.
PROSITEi PS00350. MADS_BOX_1. 1 hit.
PS50066. MADS_BOX_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "MEF2C, a MADS/MEF2-family transcription factor expressed in a laminar distribution in cerebral cortex."
    Leifer D., Krainc D., Yu Y.-T., McDermott J., Breitbart R.E., Heng J., Neve R.L., Kosofsky B., Nadal-Ginard B., Lipton S.A.
    Proc. Natl. Acad. Sci. U.S.A. 90:1546-1550(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Fetal brain and Muscle.
  2. "hMEF2C gene encodes skeletal muscle- and brain-specific transcription factors."
    McDermott J.C., Cardoso M.C., Yu Y.-T., Andres V., Leifer D., Krainc D., Lipton S.A., Nadal-Ginard B.
    Mol. Cell. Biol. 13:2564-2577(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Skeletal muscle.
  3. "Identification and characterization of a new splice variant of human MEF2C."
    Infantino V., Convertini P., Palmieri F., Iacobazzi V.
    Submitted (MAY-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Skeletal muscle.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6).
    Tissue: Skeletal muscle.
  5. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "BMK1/ERK5 regulates serum-induced early gene expression through transcription factor MEF2C."
    Kato Y., Kravchenko V.V., Tapping R.I., Han J., Ulevitch R.J., Lee J.-D.
    EMBO J. 16:7054-7066(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT THR-293; THR-300 AND SER-419, FUNCTION, MUTAGENESIS OF THR-293; THR-300 AND SER-419.
  7. "Activation of the transcription factor MEF2C by the MAP kinase p38 in inflammation."
    Han J., Jiang Y., Li Z., Kravchenko V.V., Ulevitch R.J.
    Nature 386:296-299(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT THR-293; THR-300 AND SER-419, FUNCTION, MUTAGENESIS OF THR-293; THR-300 AND SER-419.
  8. "Characterization of myocyte enhancer factor 2 (MEF2) expression in B and T cells: MEF2C is a B cell-restricted transcription factor in lymphocytes."
    Swanson B.J., Jaeck H.-M., Lyons G.E.
    Mol. Immunol. 35:445-458(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  9. "HDAC4, a human histone deacetylase related to yeast HDA1, is a transcriptional corepressor."
    Wang A.H., Bertos N.R., Vezmar M., Pelletier N., Crosato M., Heng H.H., Th'ng J., Han J., Yang X.-J.
    Mol. Cell. Biol. 19:7816-7827(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HDAC4.
  10. "Big mitogen-activated kinase regulates multiple members of the MEF2 protein family."
    Kato Y., Zhao M., Morikawa A., Sugiyama T., Chakravortty D., Koide N., Yoshida T., Tapping R.I., Yang Y., Yokochi T., Lee J.D.
    J. Biol. Chem. 275:18534-18540(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION BY MAPK7.
  11. "Cloning and characterization of a histone deacetylase, HDAC9."
    Zhou X., Marks P.A., Rifkind R.A., Richon V.M.
    Proc. Natl. Acad. Sci. U.S.A. 98:10572-10577(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HDAC9.
  12. "Dominant-interfering forms of MEF2 generated by caspase cleavage contribute to NMDA-induced neuronal apoptosis."
    Okamoto S., Li Z., Ju C., Scholzke M.N., Mathews E., Cui J., Salvesen G.S., Bossy-Wetzel E., Lipton S.A.
    Proc. Natl. Acad. Sci. U.S.A. 99:3974-3979(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEOLYTIC PROCESSING AT ASP-432, FUNCTION, MUTAGENESIS OF ASP-432.
  13. "Phosphorylation and alternative pre-mRNA splicing converge to regulate myocyte enhancer factor 2C activity."
    Zhu B., Gulick T.
    Mol. Cell. Biol. 24:8264-8275(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-396, IDENTIFICATION BY MASS SPECTROMETRY, MUTAGENESIS OF SER-396, FUNCTION OF ISOFORMS.
  14. "Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates."
    Gocke C.B., Yu H., Kang J.
    J. Biol. Chem. 280:5004-5012(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION.
  15. "Alternative pre-mRNA splicing governs expression of a conserved acidic transactivation domain in myocyte enhancer factor 2 factors of striated muscle and brain."
    Zhu B., Ramachandran B., Gulick T.
    J. Biol. Chem. 280:28749-28760(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION OF BETA DOMAIN, MUTAGENESIS OF SER-271; GLU-272; ASP-273; ASP-275; SER-387 AND SER-396.
  16. "Association with class IIa histone deacetylases upregulates the sumoylation of MEF2 transcription factors."
    Gregoire S., Yang X.-J.
    Mol. Cell. Biol. 25:2273-2287(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION AT LYS-391.
  17. "Myocyte enhancer factor 2 acetylation by p300 enhances its DNA binding activity, transcriptional activity, and myogenic differentiation."
    Ma K., Chan J.K., Zhu G., Wu Z.
    Mol. Cell. Biol. 25:3575-3582(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION AT LYS-116; LYS-119; LYS-234; LYS-239; LYS-252 AND LYS-264, INTERACTION WITH EP300, FUNCTION, DNA-BINDING, MUTAGENESIS OF LYS-116; LYS-119; LYS-234; LYS-239; LYS-252 AND LYS-264.
  18. "Phosphorylation-facilitated sumoylation of MEF2C negatively regulates its transcriptional activity."
    Kang J., Gocke C.B., Yu H.
    BMC Biochem. 7:5-5(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION AT LYS-391, MUTAGENESIS OF LYS-391 AND SER-396.
  19. "MEF2C haploinsufficiency caused by either microdeletion of the 5q14.3 region or mutation is responsible for severe mental retardation with stereotypic movements, epilepsy and/or cerebral malformations."
    Le Meur N., Holder-Espinasse M., Jaillard S., Goldenberg A., Joriot S., Amati-Bonneau P., Guichet A., Barth M., Charollais A., Journel H., Auvin S., Boucher C., Kerckaert J.P., David V., Manouvrier-Hanu S., Saugier-Veber P., Frebourg T., Dubourg C., Andrieux J., Bonneau D.
    J. Med. Genet. 47:22-29(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN MRD20.

Entry informationi

Entry nameiMEF2C_HUMAN
AccessioniPrimary (citable) accession number: Q06413
Secondary accession number(s): C9JMZ0, D7F7N5, F8W7V7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: October 29, 2014
This is version 137 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3