Q06413 (MEF2C_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 120.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Myocyte-specific enhancer factor 2C | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 473 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B-lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B-cells. May also be involved in neurogenesis and in the development of cortical architecture By similarity. Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isoform 2. Ref.6 Ref.7 Ref.12 Ref.13 Ref.15 Ref.17 |
| Subunit structure | Forms a complex with class II HDACs in undifferentiating cells. On myogenic differentiation, HDACs are released into the cytoplasm allowing MEF2s to interact with other proteins for activation. Interacts with EP300 in differentiating cells; the interaction acetylates MEF2C leading to increased DNA binding and activation. Interacts with HDAC7 and CARM1 By similarity. Interacts with HDAC4, HDAC7 AND HDAC9; the interaction WITH HDACs represses transcriptional activity. Interacts with MYOCD By similarity. Ref.9 Ref.11 Ref.17 |
| Subcellular location | |
| Tissue specificity | Expressed in brain and skeletal muscle. Ref.8 |
| Developmental stage | Expression is highest during the early stages of postnatal development, at later stages levels greatly decrease. |
| Domain | The beta domain, missing in a number of isoforms, is required for enhancement of transcriptional activity By similarity. Ref.15 |
| Post-translational modification | Phosphorylation on Ser-59 enhances DNA binding activity By similarity. Phosphorylation on Ser-396 is required for Lys-391 sumoylation and inhibits transcriptional activity. Ref.14 Ref.16 Ref.18 Acetylated by p300 on several sites in diffentiating myocytes. Acetylation on Lys-4 increases DNA binding and transactivation. Sumoylated on Lys-391 with SUMO2 but not by SUMO1 represses transcriptional activity. Ref.14 Ref.16 Ref.18 Proteolytically cleaved in cerebellar granule neurons, probably by caspase 7, following neurotoxicity. Preferentially cleaves the CDK5-mediated hyperphosphorylated form which leads to neuron apoptosis and transcriptional inactivation. Ref.6 Ref.7 Ref.10 Ref.13 |
| Involvement in disease | Mental retardation, stereotypic movements, epilepsy and/or cerebral malformations (MRSME) [MIM:613443]: A disorder characterized by severe mental retardation, absent speech, hypotonia, poor eye contact and stereotypic movements. Dysmorphic features include high broad forehead with variable small chin, short nose with anteverted nares, large open mouth, upslanted palpebral fissures and prominent eyebrows. Some patients have seizures. |
| Sequence similarities | Belongs to the MEF2 family. Contains 1 MADS-box domain. Contains 1 Mef2-type DNA-binding domain. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q06413-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q06413-2) Also known as: Muscle; The sequence of this isoform differs from the canonical sequence as follows: 271-278: Missing. | ||||||
| Isoform 3 (identifier: Q06413-3) Also known as: hMEF2C-delta32; Brain; The sequence of this isoform differs from the canonical sequence as follows: 368-399: Missing. | ||||||
| Isoform 4 (identifier: Q06413-4) The sequence of this isoform differs from the canonical sequence as follows: 87-134: Missing. 271-278: Missing. | ||||||
| Isoform 5 (identifier: Q06413-5) The sequence of this isoform differs from the canonical sequence as follows: 107-134: VGHSPESEDKYRKINEDIDLMISRQRLC → ALNKKENKGCESPDPDSSYALTPRTEEKYKKINEEFDNMIKSHKIP 271-278: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q06413-6) The sequence of this isoform differs from the canonical sequence as follows: 87-134: TLRKKGLNGC...DLMISRQRLC → ALNKKENKGC...DNMIKSHKIP 271-278: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 473 | 473 | Myocyte-specific enhancer factor 2C | PRO_0000199433 | |||||
Regions | |||||||||
| Domain | 3 – 57 | 55 | MADS-box | ||||||
| DNA binding | 58 – 86 | 29 | Mef2-type Potential | ||||||
| Region | 271 – 278 | 8 | Beta domain | ||||||
| Region | 368 – 399 | 32 | Transcription repressor | ||||||
| Compositional bias | 4 – 31 | 28 | Lys-rich (basic) | ||||||
| Compositional bias | 146 – 183 | 38 | Ser-rich | ||||||
Sites | |||||||||
| Site | 432 – 433 | 2 | Cleavage Probable | ||||||
Amino acid modifications | |||||||||
| Modified residue | 4 | 1 | N6-acetyllysine | ||||||
| Modified residue | 59 | 1 | Phosphoserine; by CK2 By similarity | ||||||
| Modified residue | 116 | 1 | N6-acetyllysine Ref.17 | ||||||
| Modified residue | 119 | 1 | N6-acetyllysine Ref.17 | ||||||
| Modified residue | 234 | 1 | N6-acetyllysine Ref.17 | ||||||
| Modified residue | 239 | 1 | N6-acetyllysine Ref.17 | ||||||
| Modified residue | 252 | 1 | N6-acetyllysine Ref.17 | ||||||
| Modified residue | 264 | 1 | N6-acetyllysine Ref.17 | ||||||
| Modified residue | 293 | 1 | Phosphothreonine; by MAPK14 Ref.6 Ref.7 | ||||||
| Modified residue | 300 | 1 | Phosphothreonine; by MAPK14 Ref.6 Ref.7 | ||||||
| Modified residue | 396 | 1 | Phosphoserine; by CDK5 Ref.13 | ||||||
| Modified residue | 419 | 1 | Phosphoserine; by MAPK7 Ref.6 Ref.7 | ||||||
| Cross-link | 391 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.16 Ref.18 | |||||||
Natural variations | |||||||||
| Alternative sequence | 87 – 134 | 48 | Missing in isoform 4. | VSP_043339 | |||||
| Alternative sequence | 87 – 134 | 48 | TLRKK…RQRLC → ALNKKENKGCESPDPDSSYA LTPRTEEKYKKINEEFDNMI KSHKIP in isoform 6. | VSP_046251 | |||||
| Alternative sequence | 107 – 134 | 28 | VGHSP…RQRLC → ALNKKENKGCESPDPDSSYA LTPRTEEKYKKINEEFDNMI KSHKIP in isoform 5. | VSP_045478 | |||||
| Alternative sequence | 271 – 278 | 8 | Missing in isoform 2, isoform 4, isoform 5 and isoform 6. | VSP_006248 | |||||
| Alternative sequence | 368 – 399 | 32 | Missing in isoform 3. | VSP_006249 | |||||
Experimental info | |||||||||
| Mutagenesis | 116 | 1 | K → R: Reduced acetylation. Further reduction in acetylation; when associated with R-119. Complete loss of acetylation, 15% less transactivation activity and slightly reduced DNA binding; when associated with R-119; R-234; R-239; R-252 and R-262. Ref.17 | ||||||
| Mutagenesis | 119 | 1 | K → R: Reduced acetylation. Further reduction in acetylation; when associated with R-119. Complete loss of acetylation, 15% less transactivation activity and slightly reduced DNA binding; when associated with R-116; R-234; R-239; R-252 and R-262. Ref.17 | ||||||
| Mutagenesis | 234 | 1 | K → R: Reduced acetylation. Complete loss of acetylation, 15% less transactivation activity and slightly reduced DNA binding; when associated with R-116; R-119; R-239; R-252 and R-264. Ref.17 | ||||||
| Mutagenesis | 239 | 1 | K → R: Reduced acetylation. Complete loss of acetylation, 15% less transactivation activity and slightly reduced DNA binding; when associated with R-116; R-119; R-234; R-252 and R-264. Ref.17 | ||||||
| Mutagenesis | 252 | 1 | K → R: Reduced acetylation. Complete loss of acetylation, 15% less transactivation activity and slightly reduced DNA binding; when associated with R-116; R-119; R-234; R-239 and R-264. Ref.17 | ||||||
| Mutagenesis | 264 | 1 | K → R: Reduced acetylation. Complete loss of acetylation, 15% less transactivation activity and slightly reduced DNA binding; when associated with R-116; R-119; R-234; R-239 and R-252. Ref.17 | ||||||
| Mutagenesis | 271 | 1 | S → A: No effect on transcriptional activation. Ref.15 | ||||||
| Mutagenesis | 272 | 1 | E → Q: Reduced transcriptional activation. Completely abolishes transcriptional activation; when associated with N-273 and N-275. Ref.15 | ||||||
| Mutagenesis | 273 | 1 | D → N: Reduced transcriptional activation. Completely abolishes transcriptional activation; when associated with Q-272 and N-275. Ref.15 | ||||||
| Mutagenesis | 275 | 1 | D → N: Reduced transcriptional activation. Completely abolishes transcriptional activation; when associated with Q-272 and N-273. Ref.15 | ||||||
| Mutagenesis | 293 | 1 | T → A: Abolishes MAPK14-mediated phosphorylation. No effect on MAPK7-mediated phosphorylation; when associated with A-300. Ref.6 Ref.7 | ||||||
| Mutagenesis | 300 | 1 | T → A: Abolishes MAPK14-mediated phosphorylation. No effect on MAPK7-mediated phosphorylation; when associated with A-293. Ref.6 Ref.7 | ||||||
| Mutagenesis | 387 | 1 | S → A: No change in transactivational activation for isoforms with or without the beta domain. Ref.15 | ||||||
| Mutagenesis | 391 | 1 | K → R: Abolishes sumoylation. Ref.18 | ||||||
| Mutagenesis | 396 | 1 | S → A or C: Abolishes sumoylation. Enhanced transcriptional activity. Ref.13 Ref.15 Ref.18 | ||||||
| Mutagenesis | 396 | 1 | S → A: No change in transactivational activation for isoforms with or without the beta domain. Ref.13 Ref.15 Ref.18 | ||||||
| Mutagenesis | 396 | 1 | S → E: No effect on sumoylation. No effect on transcriptional activity. Ref.13 Ref.15 Ref.18 | ||||||
| Mutagenesis | 419 | 1 | S → A: No effect on MAPK14-mediated phosphorylation. Abolishes MAPK7-mediated phosphorylation and reduces transactivation activity. Ref.6 Ref.7 | ||||||
| Mutagenesis | 432 | 1 | D → A: Abolishes cleavage by caspase 7. Ref.12 | ||||||
| Sequence conflict | 390 | 1 | I → T in AL833268. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "MEF2C, a MADS/MEF2-family transcription factor expressed in a laminar distribution in cerebral cortex." Leifer D., Krainc D., Yu Y.-T., McDermott J., Breitbart R.E., Heng J., Neve R.L., Kosofsky B., Nadal-Ginard B., Lipton S.A. Proc. Natl. Acad. Sci. U.S.A. 90:1546-1550(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Fetal brain and Muscle. |
| [2] | "hMEF2C gene encodes skeletal muscle- and brain-specific transcription factors." McDermott J.C., Cardoso M.C., Yu Y.-T., Andres V., Leifer D., Krainc D., Lipton S.A., Nadal-Ginard B. Mol. Cell. Biol. 13:2564-2577(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Skeletal muscle. |
| [3] | "Identification and characterization of a new splice variant of human MEF2C." Infantino V., Convertini P., Palmieri F., Iacobazzi V. Submitted (MAY-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Skeletal muscle. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6). Tissue: Skeletal muscle. |
| [5] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "BMK1/ERK5 regulates serum-induced early gene expression through transcription factor MEF2C." Kato Y., Kravchenko V.V., Tapping R.I., Han J., Ulevitch R.J., Lee J.-D. EMBO J. 16:7054-7066(1997) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-293; THR-300 AND SER-419, FUNCTION, MUTAGENESIS OF THR-293; THR-300 AND SER-419. |
| [7] | "Activation of the transcription factor MEF2C by the MAP kinase p38 in inflammation." Han J., Jiang Y., Li Z., Kravchenko V.V., Ulevitch R.J. Nature 386:296-299(1997) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-293; THR-300 AND SER-419, FUNCTION, MUTAGENESIS OF THR-293; THR-300 AND SER-419. |
| [8] | "Characterization of myocyte enhancer factor 2 (MEF2) expression in B and T cells: MEF2C is a B cell-restricted transcription factor in lymphocytes." Swanson B.J., Jaeck H.-M., Lyons G.E. Mol. Immunol. 35:445-458(1998) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [9] | "HDAC4, a human histone deacetylase related to yeast HDA1, is a transcriptional corepressor." Wang A.H., Bertos N.R., Vezmar M., Pelletier N., Crosato M., Heng H.H., Th'ng J., Han J., Yang X.-J. Mol. Cell. Biol. 19:7816-7827(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HDAC4. |
| [10] | "Big mitogen-activated kinase regulates multiple members of the MEF2 protein family." Kato Y., Zhao M., Morikawa A., Sugiyama T., Chakravortty D., Koide N., Yoshida T., Tapping R.I., Yang Y., Yokochi T., Lee J.D. J. Biol. Chem. 275:18534-18540(2000) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION BY MAPK7. |
| [11] | "Cloning and characterization of a histone deacetylase, HDAC9." Zhou X., Marks P.A., Rifkind R.A., Richon V.M. Proc. Natl. Acad. Sci. U.S.A. 98:10572-10577(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HDAC9. |
| [12] | "Dominant-interfering forms of MEF2 generated by caspase cleavage contribute to NMDA-induced neuronal apoptosis." Okamoto S., Li Z., Ju C., Scholzke M.N., Mathews E., Cui J., Salvesen G.S., Bossy-Wetzel E., Lipton S.A. Proc. Natl. Acad. Sci. U.S.A. 99:3974-3979(2002) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEOLYTIC PROCESSING AT ASP-432, FUNCTION, MUTAGENESIS OF ASP-432. |
| [13] | "Phosphorylation and alternative pre-mRNA splicing converge to regulate myocyte enhancer factor 2C activity." Zhu B., Gulick T. Mol. Cell. Biol. 24:8264-8275(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-396, MASS SPECTROMETRY, MUTAGENESIS OF SER-396, FUNCTION OF ISOFORMS. |
| [14] | "Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates." Gocke C.B., Yu H., Kang J. J. Biol. Chem. 280:5004-5012(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION. |
| [15] | "Alternative pre-mRNA splicing governs expression of a conserved acidic transactivation domain in myocyte enhancer factor 2 factors of striated muscle and brain." Zhu B., Ramachandran B., Gulick T. J. Biol. Chem. 280:28749-28760(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION OF BETA DOMAIN, MUTAGENESIS OF SER-271; GLU-272; ASP-273; ASP-275; SER-387 AND SER-396. |
| [16] | "Association with class IIa histone deacetylases upregulates the sumoylation of MEF2 transcription factors." Gregoire S., Yang X.-J. Mol. Cell. Biol. 25:2273-2287(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION AT LYS-391. |
| [17] | "Myocyte enhancer factor 2 acetylation by p300 enhances its DNA binding activity, transcriptional activity, and myogenic differentiation." Ma K., Chan J.K., Zhu G., Wu Z. Mol. Cell. Biol. 25:3575-3582(2005) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION AT LYS-116; LYS-119; LYS-234; LYS-239; LYS-252 AND LYS-264, INTERACTION WITH EP300, FUNCTION, DNA-BINDING, MUTAGENESIS OF LYS-116; LYS-119; LYS-234; LYS-239; LYS-252 AND LYS-264. |
| [18] | "Phosphorylation-facilitated sumoylation of MEF2C negatively regulates its transcriptional activity." Kang J., Gocke C.B., Yu H. BMC Biochem. 7:5-5(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION AT LYS-391, MUTAGENESIS OF LYS-391 AND SER-396. |
| [19] | "MEF2C haploinsufficiency caused by either microdeletion of the 5q14.3 region or mutation is responsible for severe mental retardation with stereotypic movements, epilepsy and/or cerebral malformations." Le Meur N., Holder-Espinasse M., Jaillard S., Goldenberg A., Joriot S., Amati-Bonneau P., Guichet A., Barth M., Charollais A., Journel H., Auvin S., Boucher C., Kerckaert J.P., David V., Manouvrier-Hanu S., Saugier-Veber P., Frebourg T., Dubourg C., Andrieux J., Bonneau D. J. Med. Genet. 47:22-29(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN MRSME. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L08895 mRNA. Translation: AAA59578.1. S57212 mRNA. Translation: AAB25838.1. FM163484 mRNA. Translation: CAQ57795.2. AL833268 mRNA. No translation available. AL833274 mRNA. No translation available. AC008525 Genomic DNA. No translation available. AC008835 Genomic DNA. No translation available. |
| IPI | IPI00215666. IPI00289092. IPI00909329. IPI00964670. IPI00969463. IPI01015483. |
| PIR | A47284. |
| RefSeq | NP_001124477.1. NM_001131005.2. NP_001180276.1. NM_001193347.1. NP_001180277.1. NM_001193348.1. NP_001180278.1. NM_001193349.1. NP_001180279.1. NM_001193350.1. NP_002388.2. NM_002397.4. |
| UniGene | Hs.649965. |
3D structure databases | |
| ProteinModelPortal | Q06413. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q06413. 9 interactions. |
| MINT | MINT-125556. |
| STRING | 9606.ENSP00000396219. |
PTM databases | |
| PhosphoSite | Q06413. |
Polymorphism databases | |
| DMDM | 2500875. |
Proteomic databases | |
| PaxDb | Q06413. |
| PRIDE | Q06413. |
Protocols and materials databases | |
| DNASU | 4208. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000340208; ENSP00000340874; ENSG00000081189. ENST00000424173; ENSP00000389610; ENSG00000081189. ENST00000437473; ENSP00000396219; ENSG00000081189. ENST00000510942; ENSP00000422390; ENSG00000081189. ENST00000514015; ENSP00000424606; ENSG00000081189. ENST00000514028; ENSP00000426665; ENSG00000081189. ENST00000539796; ENSP00000441153; ENSG00000081189. |
| GeneID | 4208. |
| KEGG | hsa:4208. |
| UCSC | uc003kji.2. human. uc003kjj.3. human. |
Organism-specific databases | |
| CTD | 4208. |
| GeneCards | GC05M088051. |
| HGNC | HGNC:6996. MEF2C. |
| HPA | HPA005533. |
| MIM | 600662. gene. 613443. phenotype. |
| neXtProt | NX_Q06413. |
| Orphanet | 228384. 5q14.3 microdeletion syndrome. |
| PharmGKB | PA30734. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5068. |
| HOGENOM | HOG000230620. |
| HOVERGEN | HBG053944. |
| InParanoid | Q06413. |
| KO | K04454. |
| OrthoDB | EOG4DFPNH. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | smad2_3nuclearpathway. Regulation of nuclear SMAD2/3 signaling. hdac_classii_pathway. Signaling events mediated by HDAC Class II. p38alphabetadownstreampathway. Signaling mediated by p38-alpha and p38-beta. mapktrkpathway. Trk receptor signaling mediated by the MAPK pathway. |
| Reactome | REACT_111045. Developmental Biology. REACT_111102. Signal Transduction. REACT_6782. TRAF6 Mediated Induction of proinflammatory cytokines. REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | Q06413. |
| Bgee | Q06413. |
| CleanEx | HS_MEF2C. |
| Genevestigator | Q06413. |
| GermOnline | ENSG00000081189. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR022102. HJURP_C. IPR002100. TF_MADSbox. [Graphical view] |
| Pfam | PF12347. HJURP_C. 1 hit. PF00319. SRF-TF. 1 hit. [Graphical view] |
| PRINTS | PR00404. MADSDOMAIN. |
| SMART | SM00432. MADS. 1 hit. [Graphical view] |
| SUPFAM | SSF55455. TF_MADSbox. 1 hit. |
| PROSITE | PS00350. MADS_BOX_1. 1 hit. PS50066. MADS_BOX_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MEF2C. human. |
| GenomeRNAi | 4208. |
| NextBio | 16578. |
| SOURCE | Search... |
Entry information
| Entry name | MEF2C_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q06413 Secondary accession number(s): C9JMZ0, D7F7N5, F8W7V7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
