Q06180 (PTN2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tyrosine-protein phosphatase non-receptor type 2 Short name=Protein-tyrosine phosphatase PTP-2 EC=3.1.3.48 Alternative name(s): MPTP | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 406 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. |
| Subunit structure | Interacts with RMDN3. Interacts with TMED9 By similarity. |
| Subcellular location | Cytoplasm. Endoplasmic reticulum By similarity. Nucleus By similarity. |
| Tissue specificity | Found in all the examined tissues. The highest expression levels were found in ovaries, testes, thymus and kidneys. Also present in spleen, mouse, liver, heart and brain. |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily. Contains 1 tyrosine-protein phosphatase domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Endoplasmic reticulum Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase Protein phosphatase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | insulin receptor signaling pathway Inferred from mutant phenotype PubMed 15632081. Source: MGI peptidyl-tyrosine dephosphorylationInferred from electronic annotation. Source: GOC |
| Cellular_component | endoplasmic reticulum Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | non-membrane spanning protein tyrosine phosphatase activity Inferred from electronic annotation. Source: Compara |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PTPB (identifier: Q06180-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PTPA (identifier: Q06180-2) The sequence of this isoform differs from the canonical sequence as follows: 377-406: WLYWQPILTKMGFVSVILVGALVGWTLLFH → PRLTDT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 406 | 406 | Tyrosine-protein phosphatase non-receptor type 2 | PRO_0000094753 | |||||
Regions | |||||||||
| Domain | 5 – 275 | 271 | Tyrosine-protein phosphatase | ||||||
| Region | 216 – 222 | 7 | Substrate binding By similarity | ||||||
Sites | |||||||||
| Active site | 216 | 1 | Phosphocysteine intermediate By similarity | ||||||
| Binding site | 182 | 1 | Substrate By similarity | ||||||
| Binding site | 260 | 1 | Substrate By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 298 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 304 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 377 – 406 | 30 | WLYWQ…TLLFH → PRLTDT in isoform PTPA. | VSP_012367 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a mouse cDNA encoding a cytoplasmic protein-tyrosine-phosphatase." Mosinger B. Jr., Tillmann U., Westphal H., Tremblay M.L. Proc. Natl. Acad. Sci. U.S.A. 89:499-503(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PTPA). |
| [2] | "Molecular cloning, nucleotide sequence and expression of a cDNA encoding an intracellular protein tyrosine phosphatase, PTPase-2, from mouse testis and T-cells." Miyasaka H., Li S.S.-L. Mol. Cell. Biochem. 118:91-98(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PTPA). Strain: C57BL/6N. Tissue: T-cell and Testis. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PTPB). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PTPB). Strain: FVB/N. Tissue: Mammary gland. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M81477 mRNA. Translation: AAA37446.1. S52655 mRNA. Translation: AAB25035.2. BC008269 mRNA. Translation: AAH08269.1. AK076072 mRNA. Translation: BAC36163.1. AK132013 mRNA. Translation: BAE20939.1. |
| IPI | IPI00515708. IPI00623994. |
| PIR | A38191. |
| RefSeq | NP_001120649.1. NM_001127177.1. NP_033003.1. NM_008977.3. |
| UniGene | Mm.260433. |
3D structure databases | |
| ProteinModelPortal | Q06180. |
| SMR | Q06180. Positions 5-277. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-5170362. |
PTM databases | |
| PhosphoSite | Q06180. |
Proteomic databases | |
| PaxDb | Q06180. |
| PRIDE | Q06180. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000025420; ENSMUSP00000025420; ENSMUSG00000024539. ENSMUST00000122412; ENSMUSP00000112675; ENSMUSG00000024539. |
| GeneID | 19255. |
| KEGG | mmu:19255. |
| UCSC | uc008fmu.2. mouse. uc008fmv.2. mouse. |
Organism-specific databases | |
| CTD | 5771. |
| MGI | MGI:97806. Ptpn2. |
Phylogenomic databases | |
| eggNOG | COG5599. |
| GeneTree | ENSGT00700000104092. |
| HOGENOM | HOG000273908. |
| HOVERGEN | HBG008321. |
| InParanoid | Q06180. |
| KO | K01104. |
| OMA | NTAQKVQ. |
| OrthoDB | EOG461447. |
Gene expression databases | |
| ArrayExpress | Q06180. |
| Bgee | Q06180. |
| CleanEx | MM_PTPN2. |
| Genevestigator | Q06180. |
| GermOnline | ENSMUSG00000024539. Mus musculus. |
Family and domain databases | |
| InterPro | IPR012265. Ptpn1/Ptpn2. IPR000387. Tyr/Dual-sp_Pase. IPR016130. Tyr_Pase_AS. IPR000242. Tyr_Pase_rcpt/non-rcpt. [Graphical view] |
| PANTHER | PTHR19134:SF57. PTHR19134:SF57. 1 hit. |
| Pfam | PF00102. Y_phosphatase. 1 hit. [Graphical view] |
| PIRSF | PIRSF000926. Tyr-Ptase_nr1. 1 hit. |
| PRINTS | PR00700. PRTYPHPHTASE. |
| SMART | SM00194. PTPc. 1 hit. [Graphical view] |
| PROSITE | PS00383. TYR_PHOSPHATASE_1. 1 hit. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50055. TYR_PHOSPHATASE_PTP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 296100. |
| SOURCE | Search... |
Entry information
| Entry name | PTN2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q06180 Secondary accession number(s): Q3V259, Q922E7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
