Q06055 (AT5G2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATP synthase proteolipid P2 ATPase protein 9 ATPase subunit c | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 141 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. |
| Subunit structure | F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. CF0 has three main subunits: a, b and c. |
| Subcellular location | |
| Miscellaneous | There are three genes which encode the mitochondrial ATP synthase proteolipid and they specify precursors with different import sequences but identical mature proteins. Is the major protein stored in the storage bodies of animals or humans affected with ceroid lipofuscinosis (Batten disease). |
| Sequence similarities | Belongs to the ATPase C chain family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q06055-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q06055-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MPELILYVAITLSVAERLVGPGHACAEPSFRSSRCSAPLCLLCSGSSSPATAPHPLKM | ||||||
| Note: Derived from EST data. | ||||||
| Isoform 3 (identifier: Q06055-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MPELILSPATAPHPLKM | ||||||
| Note: Derived from EST data. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 66 | 66 | Mitochondrion By similarity | ||||||
| Chain | 67 – 141 | 75 | ATP synthase lipid-binding protein, mitochondrial | PRO_0000002562 | |||||
Regions | |||||||||
| Transmembrane | 82 – 102 | 21 | Helical; Potential | ||||||
| Transmembrane | 117 – 137 | 21 | Helical; Potential | ||||||
Sites | |||||||||
| Site | 124 | 1 | Reversibly protonated during proton transport By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MPELILYVAITLSVAERLVG PGHACAEPSFRSSRCSAPLC LLCSGSSSPATAPHPLKM in isoform 2. | VSP_037348 | |||||
| Alternative sequence | 1 | 1 | M → MPELILSPATAPHPLKM in isoform 3. | VSP_037349 | |||||
| Natural variant | 58 | 1 | S → I. Corresponds to variant rs13819 [ dbSNP | Ensembl ]. | VAR_011920 | |||||
| Natural variant | 141 | 1 | M → K. Corresponds to variant rs1803177 [ dbSNP | Ensembl ]. | VAR_011921 | |||||
Experimental info | |||||||||
| Sequence conflict | 63 | 1 | A → T in BAG52118. Ref.3 | ||||||
| Sequence conflict | 107 | 1 | S → F in BAG52118. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequences of members of the human gene family for the c subunit of mitochondrial ATP synthase." Dyer M.R., Walker J.E. Biochem. J. 293:51-64(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [2] | "Molecular cloning and sequence of two cDNAs for human subunit c of H(+)-ATP synthase in mitochondria." Higuti T., Kawamura Y., Kuroiwa K., Miyazaki S., Tsujita H. Biochim. Biophys. Acta 1173:87-90(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries." Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. Isogai T.DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| [6] | "Human liver cDNA clones encoding proteolipid subunit 9 of the mitochondrial ATPase complex." Farrell L.B., Nagley P. Biochem. Biophys. Res. Commun. 144:1257-1264(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 87-141 (ISOFORMS 1/2/3). Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X69908 Genomic DNA. Translation: CAA49533.1. D13119 mRNA. Translation: BAA02421.1. AK075351 mRNA. Translation: BAG52118.1. AC073594 Genomic DNA. No translation available. BC020826 mRNA. Translation: AAH20826.1. |
| IPI | IPI00028482. IPI00456749. IPI00792819. |
| PIR | S34067. |
| RefSeq | NP_001002031.1. NM_001002031.2. NP_005167.2. NM_005176.5. |
| UniGene | Hs.524464. |
3D structure databases | |
| ProteinModelPortal | Q06055. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q06055. 2 interactions. |
| STRING | 9606.ENSP00000377878. |
PTM databases | |
| PhosphoSite | Q06055. |
Polymorphism databases | |
| DMDM | 461592. |
Proteomic databases | |
| PaxDb | Q06055. |
| PRIDE | Q06055. |
Protocols and materials databases | |
| DNASU | 517. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000338662; ENSP00000340315; ENSG00000135390. ENST00000394349; ENSP00000377878; ENSG00000135390. ENST00000549164; ENSP00000447317; ENSG00000135390. |
| GeneID | 517. |
| KEGG | hsa:517. |
| UCSC | uc001sec.3. human. uc001sed.3. human. uc009znc.3. human. |
Organism-specific databases | |
| CTD | 517. |
| GeneCards | GC12M054029. |
| H-InvDB | HIX0201895. |
| HGNC | HGNC:842. ATP5G2. |
| HPA | HPA051469. |
| MIM | 603193. gene. |
| neXtProt | NX_Q06055. |
| PharmGKB | PA25132. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0636. |
| HOGENOM | HOG000235246. |
| HOVERGEN | HBG050605. |
| InParanoid | Q06055. |
| KO | K02128. |
| OMA | HPLKMYT. |
| OrthoDB | EOG4X0MTN. |
| PhylomeDB | Q06055. |
Gene expression databases | |
| ArrayExpress | Q06055. |
| Bgee | Q06055. |
| CleanEx | HS_ATP5G2. |
| Genevestigator | Q06055. |
| GermOnline | ENSG00000135390. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.20.20.10. 1 hit. |
| InterPro | IPR000454. ATPase_F0-cplx_csu. IPR020537. ATPase_F0-cplx_csu_DDCD_BS. IPR002379. ATPase_proteolipid_c_like_dom. [Graphical view] |
| Pfam | PF00137. ATP-synt_C. 1 hit. [Graphical view] |
| PRINTS | PR00124. ATPASEC. |
| SUPFAM | SSF81333. ATPase_F0/V0_c. 1 hit. |
| PROSITE | PS00605. ATPASE_C. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ATP5G2. human. |
| GenomeRNAi | 517. |
| NextBio | 2145. |
| SOURCE | Search... |
Entry information
| Entry name | AT5G2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q06055 Secondary accession number(s): B3KQQ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
