Q05860 (FMN1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Formin-1 Alternative name(s): Limb deformity protein | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1466 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in the formation of adherens junction and the polymerization of linear actin cables. Ref.6 Ref.7 |
| Subunit structure | Interacts with alpha-catenin and may interact with tubulin. Ref.7 Ref.8 |
| Subcellular location | Nucleus. Cytoplasm. Cell junction › adherens junction. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note: Localization to the adherens junctions is alpha-catenin-dependent. Also localizes to F-actin bundles originating from adherens junctions. Ref.7 Ref.8 Isoform 2: Cytoplasm › cytoskeleton. Note: Isoform 2 localizes to microtubules. Ref.7 Ref.8 |
| Tissue specificity | It is present in the adult kidney, testis, limb, ovary, brain, small intestine, salivary gland and harderian gland. Isoforms 1, 2 and 5 are detected in skin and keratinocytes. Isoform 5 is found throughout the embryo. Ref.1 Ref.7 |
| Developmental stage | It is present throughout the embryo. In the developing limb bud, the protein is expressed in the apical ectodermal ridge and the mesenchymal compartment, predominantly in the posterior region. During kidney morphogenesis, expression is initially restricted to the epithelial compartment of the pronephros and mesonephros. Isoform 5 is found in the apical ectodermal ridge and the mesenchymal compartment of the developing limb bud. |
| Post-translational modification | Phosphorylated on serine and possibly threonine residues. Ref.4 |
| Miscellaneous | Was originally thought to play a role in limb bud development based on the fact that limb deformity (ld) mutants are associated with Fmn1 gene disruption. However, Ref.6 shows that limb deformity mutations rather affects Grem1 cis-regulatory regions localized in Fmn1 gene and that loss of Grem1 (gremlin-1) expression is the cause of limb malformations. |
| Sequence similarities | Belongs to the formin homology family. Cappuccino subfamily. Contains 1 FH1 (formin homology 1) domain. Contains 1 FH2 (formin homology 2) domain. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q05860-1) Also known as: IA; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q05860-2) Also known as: IB; The sequence of this isoform differs from the canonical sequence as follows: 1250-1285: Missing. | ||||||
| Isoform 3 (identifier: Q05860-3) Also known as: II; The sequence of this isoform differs from the canonical sequence as follows: 625-722: Missing. | ||||||
| Isoform 4 (identifier: Q05860-4) Also known as: III; The sequence of this isoform differs from the canonical sequence as follows: 626-627: IA → SV 628-1466: Missing. | ||||||
| Isoform 5 (identifier: Q05860-5) Also known as: IV; The sequence of this isoform differs from the canonical sequence as follows: 1-682: Missing. 683-683: N → MEEVGNSLSS...PADSPSDPKS 1250-1285: Missing. | ||||||
| Isoform 6 (identifier: Q05860-6) Also known as: V; The sequence of this isoform differs from the canonical sequence as follows: 1-623: Missing. 624-624: P → MVTTGSPPFNTMGACYRYNPRYGQPISVPKVWKCRHRRSVTPDE 1250-1285: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1466 | 1466 | Formin-1 | PRO_0000194886 | |||||
Regions | |||||||||
| Domain | 870 – 970 | 101 | FH1 | ||||||
| Domain | 983 – 1435 | 453 | FH2 | ||||||
| Region | 1 – 624 | 624 | Microtubule-binding | ||||||
| Region | 458 – 842 | 385 | Mediates interaction with alpha-catenin | ||||||
| Coiled coil | 722 – 786 | 65 | Potential | ||||||
| Compositional bias | 870 – 995 | 126 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 234 | 1 | Phosphoserine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 682 | 682 | Missing in isoform 5. | VSP_027214 | |||||
| Alternative sequence | 1 – 623 | 623 | Missing in isoform 6. | VSP_029424 | |||||
| Alternative sequence | 624 | 1 | P → MVTTGSPPFNTMGACYRYNP RYGQPISVPKVWKCRHRRSV TPDE in isoform 6. | VSP_029425 | |||||
| Alternative sequence | 625 – 722 | 98 | Missing in isoform 3. | VSP_001570 | |||||
| Alternative sequence | 626 – 627 | 2 | IA → SV in isoform 4. | VSP_001571 | |||||
| Alternative sequence | 628 – 1466 | 839 | Missing in isoform 4. | VSP_001572 | |||||
| Alternative sequence | 683 | 1 | N → MEEVGNSLSSRDVLEPDKSE AGLEMAQSILSKFSMKSLFG FTNKLDSLEPEEEDAVLKAF RSLEGDPAPERGDPSKGSDQ PQAEAPVPPDLKNDGKSARA ETGSEGSQGKGRSNTSSPGY ELSPATVSVDNEEVIWVRGT LVHTTSDSDSEDGDQEAEEE SSLDTQKPTTVVLCEPSQEP KDRAGDSEENTDTGNTDDTE LCAEESQRTLPETSSKLELG GDGSHPAEHSPRQDQAAEEG SQIPPAATDQTVGALASTVS KREAPEEKPFQLPAFFSGLR VLKKGATAEAGETITEIKPK DGDLALLKLTQRVQKSLGQG GPQTVKSPGRATDPKATPTL LEQLSQLLNIDMPRTEQKEA DPEFHGADEMGYSTDQESHK SPRDAHVQGGQVKARTPETA LEAFKALFIRPPKKGSTADT SELEALKRKMKHEKESLRAV FERSKSRPADSPSDPKS in isoform 5. | VSP_027215 | |||||
| Alternative sequence | 1250 – 1285 | 36 | Missing in isoform 2, isoform 5 and isoform 6. | VSP_027216 | |||||
Experimental info | |||||||||
| Sequence conflict | 220 | 1 | V → A in CAA37668. Ref.1 | ||||||
| Sequence conflict | 776 | 1 | G → E in CAA37668. Ref.1 | ||||||
| Sequence conflict | 776 | 1 | G → E in CAA44244. Ref.2 | ||||||
| Sequence conflict | 866 | 1 | H → Q in CAA37668. Ref.1 | ||||||
| Sequence conflict | 866 | 1 | H → Q in CAA44244. Ref.2 | ||||||
| Sequence conflict | 950 | 1 | G → GPP in CAA37668. Ref.1 | ||||||
| Sequence conflict | 950 | 1 | G → GPP in CAA44244. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "'Formins': proteins deduced from the alternative transcripts of the limb deformity gene." Woychik R.P., Maas R.L., Zeller R., Vogt T.F., Leder P. Nature 346:850-853(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ALTERNATIVE SPLICING, TISSUE SPECIFICITY. Tissue: Kidney and Testis. |
| [2] | "A variant limb deformity transcript expressed in the embryonic mouse limb defines a novel formin." Grusby-Jackson L., Kuo A., Leder P. Genes Dev. 6:29-37(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING. Tissue: Embryo. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "Formins: phosphoprotein isoforms encoded by the mouse limb deformity locus." Vogt T.F., Jackson-Grusby L., Rush J., Leder P. Proc. Natl. Acad. Sci. U.S.A. 90:5554-5558(1993) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION, ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4 AND 5). |
| [5] | "The mouse formin (Fmn) gene: genomic structure, novel exons, and genetic mapping." Wang C.C., Chan D.C., Leder P. Genomics 39:303-311(1997) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4 AND 5). |
| [6] | "Mouse limb deformity mutations disrupt a global control region within the large regulatory landscape required for Gremlin expression." Zuniga A., Michos O., Spitz F., Haramis A.-P.G., Panman L., Galli A., Vintersten K., Klasen C., Mansfield W., Kuc S., Duboule D., Dono R., Zeller R. Genes Dev. 18:1553-1564(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [7] | "Mammalian formin-1 participates in adherens junctions and polymerization of linear actin cables." Kobielak A., Pasolli H.A., Fuchs E. Nat. Cell Biol. 6:21-30(2004) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 5 AND 6), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH ALPHA-CATENIN, TISSUE SPECIFICITY. |
| [8] | "Formin-1 protein associates with microtubules through a peptide domain encoded by exon-2." Zhou F., Leder P., Martin S.S. Exp. Cell Res. 312:1119-1126(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH TUBULIN. |
| [9] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-234, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X53599 mRNA. Translation: CAA37668.1. X62379 mRNA. Translation: CAA44244.1. AL672253, AL691437 Genomic DNA. Translation: CAM14988.1. AL672253, AL691437, AL691466 Genomic DNA. Translation: CAM14989.1. AL691466, AL672253, AL691437 Genomic DNA. Translation: CAM18143.1. AL691437, AL672253 Genomic DNA. Translation: CAM18583.1. AL691437, AL672253, AL691466 Genomic DNA. Translation: CAM18585.1. | ||||||||||||||||||||||||
| IPI | IPI00114260. IPI00229709. IPI00229710. IPI00828236. IPI00828355. IPI00874986. | ||||||||||||||||||||||||
| PIR | S11515. S24407. | ||||||||||||||||||||||||
| RefSeq | NP_001036787.1. NM_001043322.1. NP_034360.2. NM_010230.2. | ||||||||||||||||||||||||
| UniGene | Mm.4938. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q05860. | ||||||||||||||||||||||||
| SMR | Q05860. Positions 970-1424. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-646N. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q05860. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q05860. | ||||||||||||||||||||||||
| PRIDE | Q05860. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENSMUST00000081349; ENSMUSP00000080093; ENSMUSG00000044042. ENSMUST00000099576; ENSMUSP00000097171; ENSMUSG00000044042. ENSMUST00000102547; ENSMUSP00000099606; ENSMUSG00000044042. | ||||||||||||||||||||||||
| GeneID | 14260. | ||||||||||||||||||||||||
| KEGG | mmu:14260. | ||||||||||||||||||||||||
| UCSC | uc008lpl.1. mouse. uc008lpm.1. mouse. uc008lpn.1. mouse. uc012cbb.1. mouse. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 342184. | ||||||||||||||||||||||||
| MGI | MGI:101815. Fmn1. | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG264408. | ||||||||||||||||||||||||
| GeneTree | ENSGT00700000104245. | ||||||||||||||||||||||||
| HOGENOM | HOG000168579. | ||||||||||||||||||||||||
| HOVERGEN | HBG107922. | ||||||||||||||||||||||||
| InParanoid | Q05860. | ||||||||||||||||||||||||
| KO | K10367. | ||||||||||||||||||||||||
| OMA | DSKSPDH. | ||||||||||||||||||||||||
| OrthoDB | EOG4KWJSD. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q05860. | ||||||||||||||||||||||||
| Bgee | Q05860. | ||||||||||||||||||||||||
| CleanEx | MM_FMN1. | ||||||||||||||||||||||||
| Genevestigator | Q05860. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR003104. Actin-bd_FH2/DRF_autoreg. IPR015425. FH2_actin-bd. IPR001265. Formin. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF02181. FH2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PRINTS | PR00828. FORMIN. | ||||||||||||||||||||||||
| SMART | SM00498. FH2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF101447. FH2_actin_bd. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS51444. FH2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| EvolutionaryTrace | Q05860. | ||||||||||||||||||||||||
| NextBio | 285597. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | FMN1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q05860 Secondary accession number(s): A2AFY9, A2AFZ0, Q05859 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
