Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q05860 (FMN1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 116. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Formin-1
Alternative name(s):
Limb deformity protein
Gene names
Name:Fmn1
Synonyms:Fmn, Ld
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1466 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Plays a role in the formation of adherens junction and the polymerization of linear actin cables. Ref.6 Ref.7

Subunit structure

Interacts with alpha-catenin and may interact with tubulin. Ref.7 Ref.8

Subcellular location

Nucleus. Cytoplasm. Cell junctionadherens junction. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note: Localization to the adherens junctions is alpha-catenin-dependent. Also localizes to F-actin bundles originating from adherens junctions. Ref.7 Ref.8

Isoform 2: Cytoplasmcytoskeleton. Note: Isoform 2 localizes to microtubules. Ref.7 Ref.8

Tissue specificity

It is present in the adult kidney, testis, limb, ovary, brain, small intestine, salivary gland and harderian gland. Isoforms 1, 2 and 5 are detected in skin and keratinocytes. Isoform 5 is found throughout the embryo. Ref.1 Ref.7

Developmental stage

It is present throughout the embryo. In the developing limb bud, the protein is expressed in the apical ectodermal ridge and the mesenchymal compartment, predominantly in the posterior region. During kidney morphogenesis, expression is initially restricted to the epithelial compartment of the pronephros and mesonephros. Isoform 5 is found in the apical ectodermal ridge and the mesenchymal compartment of the developing limb bud.

Post-translational modification

Phosphorylated on serine and possibly threonine residues. Ref.4

Miscellaneous

Was originally thought to play a role in limb bud development based on the fact that limb deformity (ld) mutants are associated with Fmn1 gene disruption. However, Ref.6 shows that limb deformity mutations rather affects Grem1 cis-regulatory regions localized in Fmn1 gene and that loss of Grem1 (gremlin-1) expression is the cause of limb malformations.

Sequence similarities

Belongs to the formin homology family. Cappuccino subfamily.

Contains 1 FH1 (formin homology 1) domain.

Contains 1 FH2 (formin homology 2) domain.

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q05860-1)

Also known as: IA;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q05860-2)

Also known as: IB;

The sequence of this isoform differs from the canonical sequence as follows:
     1250-1285: Missing.
Isoform 3 (identifier: Q05860-3)

Also known as: II;

The sequence of this isoform differs from the canonical sequence as follows:
     625-722: Missing.
Isoform 4 (identifier: Q05860-4)

Also known as: III;

The sequence of this isoform differs from the canonical sequence as follows:
     626-627: IA → SV
     628-1466: Missing.
Isoform 5 (identifier: Q05860-5)

Also known as: IV;

The sequence of this isoform differs from the canonical sequence as follows:
     1-682: Missing.
     683-683: N → MEEVGNSLSS...PADSPSDPKS
     1250-1285: Missing.
Isoform 6 (identifier: Q05860-6)

Also known as: V;

The sequence of this isoform differs from the canonical sequence as follows:
     1-623: Missing.
     624-624: P → MVTTGSPPFNTMGACYRYNPRYGQPISVPKVWKCRHRRSVTPDE
     1250-1285: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 14661466Formin-1
PRO_0000194886

Regions

Domain870 – 970101FH1
Domain983 – 1435453FH2
Region1 – 624624Microtubule-binding
Region458 – 842385Mediates interaction with alpha-catenin
Coiled coil722 – 78665 Potential
Compositional bias870 – 995126Pro-rich

Amino acid modifications

Modified residue2341Phosphoserine

Natural variations

Alternative sequence1 – 682682Missing in isoform 5.
VSP_027214
Alternative sequence1 – 623623Missing in isoform 6.
VSP_029424
Alternative sequence6241P → MVTTGSPPFNTMGACYRYNP RYGQPISVPKVWKCRHRRSV TPDE in isoform 6.
VSP_029425
Alternative sequence625 – 72298Missing in isoform 3.
VSP_001570
Alternative sequence626 – 6272IA → SV in isoform 4.
VSP_001571
Alternative sequence628 – 1466839Missing in isoform 4.
VSP_001572
Alternative sequence6831N → MEEVGNSLSSRDVLEPDKSE AGLEMAQSILSKFSMKSLFG FTNKLDSLEPEEEDAVLKAF RSLEGDPAPERGDPSKGSDQ PQAEAPVPPDLKNDGKSARA ETGSEGSQGKGRSNTSSPGY ELSPATVSVDNEEVIWVRGT LVHTTSDSDSEDGDQEAEEE SSLDTQKPTTVVLCEPSQEP KDRAGDSEENTDTGNTDDTE LCAEESQRTLPETSSKLELG GDGSHPAEHSPRQDQAAEEG SQIPPAATDQTVGALASTVS KREAPEEKPFQLPAFFSGLR VLKKGATAEAGETITEIKPK DGDLALLKLTQRVQKSLGQG GPQTVKSPGRATDPKATPTL LEQLSQLLNIDMPRTEQKEA DPEFHGADEMGYSTDQESHK SPRDAHVQGGQVKARTPETA LEAFKALFIRPPKKGSTADT SELEALKRKMKHEKESLRAV FERSKSRPADSPSDPKS in isoform 5.
VSP_027215
Alternative sequence1250 – 128536Missing in isoform 2, isoform 5 and isoform 6.
VSP_027216

Experimental info

Sequence conflict2201V → A in CAA37668. Ref.1
Sequence conflict7761G → E in CAA37668. Ref.1
Sequence conflict7761G → E in CAA44244. Ref.2
Sequence conflict8661H → Q in CAA37668. Ref.1
Sequence conflict8661H → Q in CAA44244. Ref.2
Sequence conflict9501G → GPP in CAA37668. Ref.1
Sequence conflict9501G → GPP in CAA44244. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (IA) [UniParc].

Last modified July 24, 2007. Version 2.
Checksum: 5482F8AAB66CBF32

FASTA1,466163,581
        10         20         30         40         50         60 
MEGTHCTLQL HNPIAELCYI SFYLPKGEVR GFSYKGTVTL DRSNNAFHNC YQVREGPDIT 

        70         80         90        100        110        120 
SLSQQPNEHP GDIFFKQTPT KNILTELYKL TAEKERLLDS LLRSDNILGV SMGSQEGKLQ 

       130        140        150        160        170        180 
ELSVILATGD EYFQSAGNWR RELPVSSLIR RSTQENKKPR RSGRRRESPE ELRQKRTRRK 

       190        200        210        220        230        240 
GRGCQESAFQ MGKDQVCSSS SLSFRARPNL RLLEERGNLV PRGTLTSSLR RRESCPANIL 

       250        260        270        280        290        300 
RTPDADLAFG NSGRTSEDTD LEGPLSPDSS PTEVGDADVG GQLKSSHQQE PPQPNVSESH 

       310        320        330        340        350        360 
GKHAGAERWS SRTRKSKSLE RTCSKKPVSK VVAKIQEPSA PVKRIVRAHH DGKGRVAYGP 

       370        380        390        400        410        420 
ETQTEFIPKA DFLTLPGGET ETHSSGRLEE EQPGIKSLRS SAPERASITK EPASTEAAVN 

       430        440        450        460        470        480 
KVLRKVIESE KLDEATEGKR LGFSLNTRAT HTFPETRSQR KAGLPQSGHK FLLLDLPHTV 

       490        500        510        520        530        540 
GPDSPQPKCD EKKPTPQVPT ALGMVFNNSS PQSSAHKRLS PVPSPLSPRC PSPQQHHRIL 

       550        560        570        580        590        600 
LLPPLPSEGE VVFNEYPSRK NDVSSGFPSA DTLEPSSTTK VTETKGASPT SLRASQTWLV 

       610        620        630        640        650        660 
SEEASEKGLG PEKITAPPQH QLPPGIASEG FPCDNFKEQT AKDLPNKDGG VWVPGYRAGP 

       670        680        690        700        710        720 
PCPFLLHEEK EKTSRSELYL DLNPDQSPTE QDDRTPGRLQ AVWPPPKTKD TEEKVGLKYT 

       730        740        750        760        770        780 
EAEYQAAILH LKREHKEEIE TLQAQFELKT FHIRGEHALV TARLEEAIEN LKQQLGKRRE 

       790        800        810        820        830        840 
GCEEMRDVCI STDDDCSPKA FRNVCIQTDR ETFLKPCDAE SKATRSSQIV PKKLTISLTQ 

       850        860        870        880        890        900 
LSPSKDSKDI HAPFQTREGT SSSSQHKISP PAPPTPPPLP PPLIPPPPPL PPGLGPLPPA 

       910        920        930        940        950        960 
PPIPPVCPVS PPPPPPPPPP TPVPPSDGPP PPPPPPPPLP NVLALPNSGG PPPPPPPPPP 

       970        980        990       1000       1010       1020 
GLAPPPPPGL SFGLSSSSSQ YPRKPAIEPS CPMKPLYWTR IQINDKSQDA APTLWDSLEE 

      1030       1040       1050       1060       1070       1080 
PHIRDTSEFE YLFSKDTTQQ KKKPLSEAYE KKNKVKKIIK LLDGKRSQTV GILISSLHLE 

      1090       1100       1110       1120       1130       1140 
MKDIQQAIFT VDDSVVDLET LAALYENRAQ EDELTKIRKY YETSKEEDLK LLDKPEQFLH 

      1150       1160       1170       1180       1190       1200 
ELAQIPNFAE RAQCIIFRAV FSEGITSLHR KVEIVTRASK GLLHMKSVKD ILALILAFGN 

      1210       1220       1230       1240       1250       1260 
YMNGGNRTRG QADGYSLEIL PKLKDVKSRD NGMNLVDYVV KYYLRYYDQC KHHDQEASCR 

      1270       1280       1290       1300       1310       1320 
GKDLFSLYFH IAVHPQRKSG LELKQEAGTD KSVFPLPEPQ DFFLASQVKF EDLLKDLRKL 

      1330       1340       1350       1360       1370       1380 
KRQLEASEQQ MKLVCKESPR EYLQPFKDKL EEFFKKAKKE HKMEESHLEN AQKSFETTVG 

      1390       1400       1410       1420       1430       1440 
YFGMKPKTGE KEVTPSYVFM VWFEFCSDFK TIWKRESKNI SKERLKMAQA SVSKLTSEKK 

      1450       1460 
VETKKINPTA SLKERLRQKE ASVATN 

« Hide

Isoform 2 (IB) [UniParc].

Checksum: 6A90287624580946
Show »

FASTA1,430159,391
Isoform 3 (II) [UniParc].

Checksum: F34DEB5CF39489AA
Show »

FASTA1,368152,641
Isoform 4 (III) [UniParc].

Checksum: F25AF953C733E24F
Show »

FASTA62768,996
Isoform 5 (IV) [UniParc].

Checksum: 8724170303A83D33
Show »

FASTA1,204133,207
Isoform 6 (V) [UniParc].

Checksum: 173EC42FD49F66D9
Show »

FASTA85095,723

References

« Hide 'large scale' references
[1]"'Formins': proteins deduced from the alternative transcripts of the limb deformity gene."
Woychik R.P., Maas R.L., Zeller R., Vogt T.F., Leder P.
Nature 346:850-853(1990) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
Tissue: Kidney and Testis.
[2]"A variant limb deformity transcript expressed in the embryonic mouse limb defines a novel formin."
Grusby-Jackson L., Kuo A., Leder P.
Genes Dev. 6:29-37(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING.
Tissue: Embryo.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"Formins: phosphoprotein isoforms encoded by the mouse limb deformity locus."
Vogt T.F., Jackson-Grusby L., Rush J., Leder P.
Proc. Natl. Acad. Sci. U.S.A. 90:5554-5558(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION, ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4 AND 5).
[5]"The mouse formin (Fmn) gene: genomic structure, novel exons, and genetic mapping."
Wang C.C., Chan D.C., Leder P.
Genomics 39:303-311(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4 AND 5).
[6]"Mouse limb deformity mutations disrupt a global control region within the large regulatory landscape required for Gremlin expression."
Zuniga A., Michos O., Spitz F., Haramis A.-P.G., Panman L., Galli A., Vintersten K., Klasen C., Mansfield W., Kuc S., Duboule D., Dono R., Zeller R.
Genes Dev. 18:1553-1564(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[7]"Mammalian formin-1 participates in adherens junctions and polymerization of linear actin cables."
Kobielak A., Pasolli H.A., Fuchs E.
Nat. Cell Biol. 6:21-30(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING (ISOFORMS 5 AND 6), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH ALPHA-CATENIN, TISSUE SPECIFICITY.
[8]"Formin-1 protein associates with microtubules through a peptide domain encoded by exon-2."
Zhou F., Leder P., Martin S.S.
Exp. Cell Res. 312:1119-1126(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, INTERACTION WITH TUBULIN.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X53599 mRNA. Translation: CAA37668.1.
X62379 mRNA. Translation: CAA44244.1.
AL672253, AL691437 Genomic DNA. Translation: CAM14988.1.
AL672253, AL691437, AL691466 Genomic DNA. Translation: CAM14989.1.
AL691466, AL672253, AL691437 Genomic DNA. Translation: CAM18143.1.
AL691437, AL672253 Genomic DNA. Translation: CAM18583.1.
AL691437, AL672253, AL691466 Genomic DNA. Translation: CAM18585.1.
PIRS11515.
S24407.
RefSeqNP_001272388.1. NM_001285459.1.
NP_034360.2. NM_010230.2.
UniGeneMm.4938.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2JUPNMR-P881-888[»]
2RLYNMR-P874-881[»]
2RM0NMR-P880-888[»]
ProteinModelPortalQ05860.
SMRQ05860. Positions 970-1424.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid199711. 6 interactions.
DIPDIP-646N.

PTM databases

PhosphoSiteQ05860.

Proteomic databases

PaxDbQ05860.
PRIDEQ05860.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000081349; ENSMUSP00000080093; ENSMUSG00000044042. [Q05860-5]
ENSMUST00000099576; ENSMUSP00000097171; ENSMUSG00000044042. [Q05860-2]
ENSMUST00000102547; ENSMUSP00000099606; ENSMUSG00000044042. [Q05860-1]
GeneID14260.
KEGGmmu:14260.
UCSCuc008lpl.1. mouse. [Q05860-1]
uc008lpm.1. mouse. [Q05860-2]
uc008lpn.1. mouse. [Q05860-5]

Organism-specific databases

CTD342184.
MGIMGI:101815. Fmn1.

Phylogenomic databases

eggNOGNOG264408.
GeneTreeENSGT00750000117268.
HOGENOMHOG000168579.
HOVERGENHBG107922.
InParanoidQ05860.
KOK10367.
OMADSKSPDH.
OrthoDBEOG78M01H.
PhylomeDBQ05860.
TreeFamTF351317.

Gene expression databases

ArrayExpressQ05860.
BgeeQ05860.
CleanExMM_FMN1.
GenevestigatorQ05860.

Family and domain databases

InterProIPR015425. FH2_Formin.
IPR001265. Formin_Cappuccino_subfam.
[Graphical view]
PfamPF02181. FH2. 1 hit.
[Graphical view]
PRINTSPR00828. FORMIN.
SMARTSM00498. FH2. 1 hit.
[Graphical view]
PROSITEPS51444. FH2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ05860.
NextBio285597.
PROQ05860.
SOURCESearch...

Entry information

Entry nameFMN1_MOUSE
AccessionPrimary (citable) accession number: Q05860
Secondary accession number(s): A2AFY9, A2AFZ0, Q05859
Entry history
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: July 24, 2007
Last modified: April 16, 2014
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot