Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Beta-adducin

Gene

Add2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to the erythrocyte membrane receptor SLC2A1/GLUT1 and may therefore provide a link between the spectrin cytoskeleton to the plasma membrane. Binds to calmodulin. Calmodulin binds preferentially to the beta subunit (By similarity).By similarity

GO - Molecular functioni

  • structural constituent of cytoskeleton Source: RGD

GO - Biological processi

  • ion transport Source: RGD
  • protein complex assembly Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Actin-binding, Calmodulin-binding

Enzyme and pathway databases

ReactomeiR-RNO-5223345. Miscellaneous transport and binding events.

Names & Taxonomyi

Protein namesi
Recommended name:
Beta-adducin
Alternative name(s):
Adducin-63
Erythrocyte adducin subunit beta
Gene namesi
Name:Add2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 4

Organism-specific databases

RGDi2042. Add2.

Subcellular locationi

GO - Cellular componenti

  • cytoplasmic, membrane-bounded vesicle Source: UniProtKB
  • cytoskeleton Source: RGD
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 725724Beta-adducinPRO_0000218535Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserineBy similarity
Modified residuei11 – 111PhosphoserineCombined sources
Modified residuei25 – 251PhosphoserineCombined sources
Modified residuei55 – 551PhosphothreonineBy similarity
Modified residuei60 – 601PhosphoserineCombined sources
Modified residuei344 – 3441PhosphoserineBy similarity
Modified residuei396 – 3961PhosphoserineBy similarity
Modified residuei455 – 4551PhosphoserineBy similarity
Modified residuei530 – 5301PhosphoserineCombined sources
Modified residuei532 – 5321PhosphoserineCombined sources
Modified residuei533 – 5331PhosphothreonineBy similarity
Modified residuei535 – 5351PhosphoserineBy similarity
Modified residuei594 – 5941PhosphoserineCombined sources
Modified residuei598 – 5981PhosphoserineBy similarity
Modified residuei602 – 6021PhosphoserineCombined sources
Modified residuei606 – 6061PhosphoserineBy similarity
Modified residuei612 – 6121PhosphothreonineBy similarity
Modified residuei614 – 6141PhosphoserineCombined sources
Modified residuei618 – 6181PhosphoserineCombined sources
Modified residuei620 – 6201PhosphoserineBy similarity
Modified residuei674 – 6741PhosphothreonineCombined sources
Modified residuei678 – 6781PhosphoserineCombined sources
Modified residuei685 – 6851PhosphoserineCombined sources
Modified residuei688 – 6881PhosphoserineCombined sources
Modified residuei692 – 6921PhosphoserineCombined sources
Modified residuei696 – 6961PhosphoserineBy similarity
Modified residuei698 – 6981PhosphoserineBy similarity
Modified residuei700 – 7001PhosphoserineBy similarity
Modified residuei702 – 7021PhosphoserineBy similarity
Modified residuei712 – 7121PhosphoserineBy similarity
Isoform 2 (identifier: Q05764-2)
Modified residuei561 – 5611PhosphothreonineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ05764.
PRIDEiQ05764.

PTM databases

iPTMnetiQ05764.
PhosphoSiteiQ05764.

Expressioni

Tissue specificityi

Found in liver, kidney, spleen, heart and brain.

Gene expression databases

ExpressionAtlasiQ05764. baseline and differential.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. Found in a complex with ADD2, DMTN and SLC2A1. Interacts with SLC2A1 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000021491.

Structurei

3D structure databases

ProteinModelPortaliQ05764.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni425 – 44420Interaction with calmodulinSequence analysisAdd
BLAST
Regioni703 – 72018Interaction with calmodulinSequence analysisAdd
BLAST

Domaini

Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3699. Eukaryota.
COG0235. LUCA.
GeneTreeiENSGT00390000016462.
HOGENOMiHOG000116349.
HOVERGENiHBG004180.
InParanoidiQ05764.
KOiK18622.
PhylomeDBiQ05764.

Family and domain databases

Gene3Di3.40.225.10. 1 hit.
InterProiIPR027773. ADD2.
IPR001303. Aldolase_II/adducin_N.
[Graphical view]
PANTHERiPTHR10672:SF6. PTHR10672:SF6. 1 hit.
PfamiPF00596. Aldolase_II. 1 hit.
[Graphical view]
SMARTiSM01007. Aldolase_II. 1 hit.
[Graphical view]
SUPFAMiSSF53639. SSF53639. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q05764-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEDTVPEAA SPPPSQGQHY FDRFSEDDPE YLRLRNRAAD LRQDFNLMEQ
60 70 80 90 100
KKRVTMILQS PSFREELEGL IQEQMKKGNN SSNIWALRQI ADFMASTSHA
110 120 130 140 150
VFPASSMNFS MMTPINDLHT ADSLNLAKGE RLMRCKISSV YRLLDLYGWA
160 170 180 190 200
QLSDTYVTLR VSKEQDHFLI SPKGVSCSEV TASSLIKVNI LGEVVEKGSS
210 220 230 240 250
CFPVDTTGFS LHSAIYAARP DVRCAIHLHT PATAAVSAMK CGLLPVSHNA
260 270 280 290 300
LLVGDMAYYD FNGEMEQEAD RINLQKCLGP TCKILVLRNH GMVALGDTVE
310 320 330 340 350
EAFYKVFHLQ AACEVQVSAL SSAGGTENLI LLEQEKHRPH EVGSVQWAGS
360 370 380 390 400
TFGPMQKSRL GEHEFEALMR MLDNLGYRTG YTYRHPFVQE KTKHKSEVEI
410 420 430 440 450
PATVTAFVFE EDGVPVPALR QHAQKQQKEK TRWLNTPNTY LRVNVADEVQ
460 470 480 490 500
RNMGSPRPKT TWMKADEVEK SSSGMPIRIE NPNQFVPLYT DPQEVLDMRN
510 520 530 540 550
KIREQNRQDI KSAGPQSQLL ASVIAEKSRS PSTESQLASK GDADTKDELE
560 570 580 590 600
ETVPNPFSQL TDQELEEYKK EVERKKLEQE QEGEKDAATE EPGSPVKSTP
610 620 630 640 650
ASPVQSPTRA GTKSPAVSPS KASEDAKKTE VSEANTEPEP EKPEGVVVNG
660 670 680 690 700
KEEEPCVEEV LSKGPGQMTT NADTDGDSYK DKTESVTSGP LSPEGSPSKS
710 720
PSKKKKKFRT PSFLKKSKKK EKVES
Length:725
Mass (Da):80,593
Last modified:January 23, 2007 - v4
Checksum:i0715BD6A75B3D174
GO
Isoform 2 (identifier: Q05764-2) [UniParc]FASTAAdd to basket
Also known as: Adducin 63

The sequence of this isoform differs from the canonical sequence as follows:
     532-562: STESQLASKGDADTKDELEETVPNPFSQLTD → VQQRLPPTEGEAYQTPGAGQGTPESSGPLTP
     563-725: Missing.

Show »
Length:562
Mass (Da):62,788
Checksum:iAECF299694E44CB8
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti529 – 5291R → Q in strain: Milan hypertensive.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei532 – 56231STESQ…SQLTD → VQQRLPPTEGEAYQTPGAGQ GTPESSGPLTP in isoform 2. 1 PublicationVSP_000186Add
BLAST
Alternative sequencei563 – 725163Missing in isoform 2. 1 PublicationVSP_000187Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M63894 mRNA. Translation: AAA40679.1.
AF130338 mRNA. Translation: AAF31764.1.
PIRiJQ1036.
RefSeqiNP_001103350.1. NM_001109880.1.
NP_036623.1. NM_012491.2. [Q05764-2]
UniGeneiRn.11353.

Genome annotation databases

EnsembliENSRNOT00000081173; ENSRNOP00000073973; ENSRNOG00000015903. [Q05764-2]
GeneIDi24171.
KEGGirno:24171.
UCSCiRGD:2042. rat. [Q05764-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M63894 mRNA. Translation: AAA40679.1.
AF130338 mRNA. Translation: AAF31764.1.
PIRiJQ1036.
RefSeqiNP_001103350.1. NM_001109880.1.
NP_036623.1. NM_012491.2. [Q05764-2]
UniGeneiRn.11353.

3D structure databases

ProteinModelPortaliQ05764.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000021491.

PTM databases

iPTMnetiQ05764.
PhosphoSiteiQ05764.

Proteomic databases

PaxDbiQ05764.
PRIDEiQ05764.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000081173; ENSRNOP00000073973; ENSRNOG00000015903. [Q05764-2]
GeneIDi24171.
KEGGirno:24171.
UCSCiRGD:2042. rat. [Q05764-1]

Organism-specific databases

CTDi119.
RGDi2042. Add2.

Phylogenomic databases

eggNOGiKOG3699. Eukaryota.
COG0235. LUCA.
GeneTreeiENSGT00390000016462.
HOGENOMiHOG000116349.
HOVERGENiHBG004180.
InParanoidiQ05764.
KOiK18622.
PhylomeDBiQ05764.

Enzyme and pathway databases

ReactomeiR-RNO-5223345. Miscellaneous transport and binding events.

Miscellaneous databases

PROiQ05764.

Gene expression databases

ExpressionAtlasiQ05764. baseline and differential.

Family and domain databases

Gene3Di3.40.225.10. 1 hit.
InterProiIPR027773. ADD2.
IPR001303. Aldolase_II/adducin_N.
[Graphical view]
PANTHERiPTHR10672:SF6. PTHR10672:SF6. 1 hit.
PfamiPF00596. Aldolase_II. 1 hit.
[Graphical view]
SMARTiSM01007. Aldolase_II. 1 hit.
[Graphical view]
SUPFAMiSSF53639. SSF53639. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiADDB_RAT
AccessioniPrimary (citable) accession number: Q05764
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: January 23, 2007
Last modified: July 6, 2016
This is version 124 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.