Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q05749 (PIT1_MELGA) Reviewed, UniProtKB/Swiss-Prot

Last modified February 19, 2014. Version 92. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Pituitary-specific positive transcription factor 1

Short name=PIT-1
Alternative name(s):
Growth hormone factor 1
Short name=GHF-1
Gene names
Name:POU1F1
Synonyms:PIT1
OrganismMeleagris gallopavo (Common turkey) [Reference proteome]
Taxonomic identifier9103 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiTestudines + Archosauria groupArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalliformesPhasianidaeMeleagridinaeMeleagris

Protein attributes

Sequence length370 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Transcription factor that activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Subcellular location

Nucleus.

Tissue specificity

Pituitary gland.

Sequence similarities

Belongs to the POU transcription factor family. Class-1 subfamily.

Contains 1 homeobox DNA-binding domain.

Contains 1 POU-specific domain.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   DomainHomeobox
   LigandDNA-binding
   Molecular functionActivator
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processtranscription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionsequence-specific DNA binding

Inferred from electronic annotation. Source: InterPro

sequence-specific DNA binding transcription factor activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform PIT-1beta* (identifier: Q05749-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform PIT-1 (identifier: Q05749-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: MTCQAFASSDNFVPLNSDSSPSLPLIMHHSAAECLPVSNHATSVVST → MYLESSCVFLP
Isoform PIT-1* (identifier: Q05749-3)

The sequence of this isoform differs from the canonical sequence as follows:
     48-75: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 370370Pituitary-specific positive transcription factor 1
PRO_0000100704

Regions

Domain202 – 27675POU-specific
DNA binding292 – 35160Homeobox

Natural variations

Alternative sequence1 – 4747MTCQA…SVVST → MYLESSCVFLP in isoform PIT-1.
VSP_002318
Alternative sequence48 – 7528Missing in isoform PIT-1*.
VSP_002319

Sequences

Sequence LengthMass (Da)Tools
Isoform PIT-1beta* [UniParc].

Last modified October 1, 1996. Version 2.
Checksum: AB2ABFCBE257C171

FASTA37041,191
        10         20         30         40         50         60 
MTCQAFASSD NFVPLNSDSS PSLPLIMHHS AAECLPVSNH ATSVVSTVPS VLSLIQTPKC 

        70         80         90        100        110        120 
SHLHFAMMTS GNVSAGLHYS VPSCHYGNQT STYGVMTGIK PATPEMLSAS LSQSRILQTC 

       130        140        150        160        170        180 
SMPHPNVVNG VSTLQSKSFS FSCSLTPCLY KFPEHALSAS SCALGHSFTP MHQTLLSDDP 

       190        200        210        220        230        240 
TAADFKQEFR RKSKSVEEPV DMDSPEIREL EKFANEFKLR RIKLGYTQTN VGEALAAVHG 

       250        260        270        280        290        300 
SEFSQTTICR FENSQLSFKN ACKLKSILSK WLEEAEQVGA LYNEKVGVNE RKRKRRTTIS 

       310        320        330        340        350        360 
IAAKEALERH FGEQSKPSSQ EIMRMAEGLN LEKEVVRVWF CNRRQREKRV KTSLHQNAFS 

       370 
SIIKEHHECR 

« Hide

Isoform PIT-1 [UniParc].

Checksum: 59380B169C5727B1
Show »

FASTA33437,577
Isoform PIT-1* [UniParc].

Checksum: E5ED97A45197931B
Show »

FASTA34238,252

References

[1]"Complementary DNA cloning and expression of Pit-1/GHF-1 from the domestic turkey."
Wong E.A., Silsby J.L., el Halawani M.E.
DNA Cell Biol. 11:651-660(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Tissue: Pituitary.
[2]Wong E.A., Sharova L., Kurima K., Weatherly K.L.
Submitted (JAN-1995) to the EMBL/GenBank/DDBJ databases
Cited for: SEQUENCE REVISION, ALTERNATIVE SPLICING.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U18928 expand/collapse EMBL AC list , U62732, U18923, U18924, U18925, U18926, U18927 Genomic DNA. Translation: AAB04690.1.
U18928 expand/collapse EMBL AC list , U62732, U18923, U18924, U18925, U18926, U18927 Genomic DNA. Translation: AAB04691.1.
U18928 expand/collapse EMBL AC list , U18923, U18924, U18925, U18926, U18927 Genomic DNA. Translation: AAB04692.1.
X69471 mRNA. Translation: CAA49229.1. Sequence problems.
PIRS26693.
UniGeneMga.4351.

3D structure databases

ProteinModelPortalQ05749.
SMRQ05749. Positions 207-351.
ModBaseSearch...
MobiDBSearch...

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Phylogenomic databases

HOVERGENHBG053120.

Family and domain databases

Gene3D1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
IPR015586. Pit_1.
IPR013847. POU.
IPR000327. POU_specific.
[Graphical view]
PANTHERPTHR11636:SF17. PTHR11636:SF17. 1 hit.
PfamPF00046. Homeobox. 1 hit.
PF00157. Pou. 1 hit.
[Graphical view]
PRINTSPR00028. POUDOMAIN.
SMARTSM00389. HOX. 1 hit.
SM00352. POU. 1 hit.
[Graphical view]
SUPFAMSSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00035. POU_1. 1 hit.
PS00465. POU_2. 1 hit.
PS51179. POU_3. 1 hit.
[Graphical view]
ProtoNetSearch...

Entry information

Entry namePIT1_MELGA
AccessionPrimary (citable) accession number: Q05749
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: October 1, 1996
Last modified: February 19, 2014
This is version 92 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families