SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q05749

- PIT1_MELGA

UniProt

Q05749 - PIT1_MELGA

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Pituitary-specific positive transcription factor 1

Gene
POU1F1, PIT1
Organism
Meleagris gallopavo (Common turkey)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Transcription factor that activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi292 – 35160HomeoboxAdd
BLAST

GO - Molecular functioni

  1. sequence-specific DNA binding Source: InterPro
  2. sequence-specific DNA binding transcription factor activity Source: InterPro

GO - Biological processi

  1. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Pituitary-specific positive transcription factor 1
Short name:
PIT-1
Alternative name(s):
Growth hormone factor 1
Short name:
GHF-1
Gene namesi
Name:POU1F1
Synonyms:PIT1
OrganismiMeleagris gallopavo (Common turkey)
Taxonomic identifieri9103 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiTestudines + Archosauria groupArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalliformesPhasianidaeMeleagridinaeMeleagris
ProteomesiUP000001645: Unplaced

Subcellular locationi

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 370370Pituitary-specific positive transcription factor 1PRO_0000100704Add
BLAST

Expressioni

Tissue specificityi

Pituitary gland.

Structurei

3D structure databases

ProteinModelPortaliQ05749.
SMRiQ05749. Positions 207-351.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini202 – 27675POU-specificAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Homeobox

Phylogenomic databases

HOVERGENiHBG053120.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProiIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
IPR015586. Pit_1.
IPR013847. POU.
IPR000327. POU_specific.
[Graphical view]
PANTHERiPTHR11636:SF82. PTHR11636:SF82. 1 hit.
PfamiPF00046. Homeobox. 1 hit.
PF00157. Pou. 1 hit.
[Graphical view]
PRINTSiPR00028. POUDOMAIN.
SMARTiSM00389. HOX. 1 hit.
SM00352. POU. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEiPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00035. POU_1. 1 hit.
PS00465. POU_2. 1 hit.
PS51179. POU_3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform PIT-1beta* (identifier: Q05749-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTCQAFASSD NFVPLNSDSS PSLPLIMHHS AAECLPVSNH ATSVVSTVPS    50
VLSLIQTPKC SHLHFAMMTS GNVSAGLHYS VPSCHYGNQT STYGVMTGIK 100
PATPEMLSAS LSQSRILQTC SMPHPNVVNG VSTLQSKSFS FSCSLTPCLY 150
KFPEHALSAS SCALGHSFTP MHQTLLSDDP TAADFKQEFR RKSKSVEEPV 200
DMDSPEIREL EKFANEFKLR RIKLGYTQTN VGEALAAVHG SEFSQTTICR 250
FENSQLSFKN ACKLKSILSK WLEEAEQVGA LYNEKVGVNE RKRKRRTTIS 300
IAAKEALERH FGEQSKPSSQ EIMRMAEGLN LEKEVVRVWF CNRRQREKRV 350
KTSLHQNAFS SIIKEHHECR 370
Length:370
Mass (Da):41,191
Last modified:October 1, 1996 - v2
Checksum:iAB2ABFCBE257C171
GO
Isoform PIT-1 (identifier: Q05749-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: MTCQAFASSDNFVPLNSDSSPSLPLIMHHSAAECLPVSNHATSVVST → MYLESSCVFLP

Show »
Length:334
Mass (Da):37,577
Checksum:i59380B169C5727B1
GO
Isoform PIT-1* (identifier: Q05749-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-75: Missing.

Show »
Length:342
Mass (Da):38,252
Checksum:iE5ED97A45197931B
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4747MTCQA…SVVST → MYLESSCVFLP in isoform PIT-1. VSP_002318Add
BLAST
Alternative sequencei48 – 7528Missing in isoform PIT-1*. VSP_002319Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U18928
, U62732, U18923, U18924, U18925, U18926, U18927 Genomic DNA. Translation: AAB04690.1.
U18928
, U62732, U18923, U18924, U18925, U18926, U18927 Genomic DNA. Translation: AAB04691.1.
U18928
, U18923, U18924, U18925, U18926, U18927 Genomic DNA. Translation: AAB04692.1.
X69471 mRNA. Translation: CAA49229.1. Sequence problems.
PIRiS26693.
UniGeneiMga.4351.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U18928
, U62732 , U18923 , U18924 , U18925 , U18926 , U18927 Genomic DNA. Translation: AAB04690.1 .
U18928
, U62732 , U18923 , U18924 , U18925 , U18926 , U18927 Genomic DNA. Translation: AAB04691.1 .
U18928
, U18923 , U18924 , U18925 , U18926 , U18927 Genomic DNA. Translation: AAB04692.1 .
X69471 mRNA. Translation: CAA49229.1 . Sequence problems.
PIRi S26693.
UniGenei Mga.4351.

3D structure databases

ProteinModelPortali Q05749.
SMRi Q05749. Positions 207-351.
ModBasei Search...
MobiDBi Search...

Protocols and materials databases

Structural Biology Knowledgebase Search...

Phylogenomic databases

HOVERGENi HBG053120.

Family and domain databases

Gene3Di 1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProi IPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
IPR015586. Pit_1.
IPR013847. POU.
IPR000327. POU_specific.
[Graphical view ]
PANTHERi PTHR11636:SF82. PTHR11636:SF82. 1 hit.
Pfami PF00046. Homeobox. 1 hit.
PF00157. Pou. 1 hit.
[Graphical view ]
PRINTSi PR00028. POUDOMAIN.
SMARTi SM00389. HOX. 1 hit.
SM00352. POU. 1 hit.
[Graphical view ]
SUPFAMi SSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEi PS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00035. POU_1. 1 hit.
PS00465. POU_2. 1 hit.
PS51179. POU_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complementary DNA cloning and expression of Pit-1/GHF-1 from the domestic turkey."
    Wong E.A., Silsby J.L., el Halawani M.E.
    DNA Cell Biol. 11:651-660(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Tissue: Pituitary.
  2. Wong E.A., Sharova L., Kurima K., Weatherly K.L.
    Submitted (JAN-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION, ALTERNATIVE SPLICING.

Entry informationi

Entry nameiPIT1_MELGA
AccessioniPrimary (citable) accession number: Q05749
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: October 1, 1996
Last modified: June 11, 2014
This is version 94 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi