Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q05749

- PIT1_MELGA

UniProt

Q05749 - PIT1_MELGA

Protein

Pituitary-specific positive transcription factor 1

Gene

POU1F1

Organism
Meleagris gallopavo (Common turkey)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 95 (01 Oct 2014)
      Sequence version 2 (01 Oct 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcription factor that activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi292 – 35160HomeoboxPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. sequence-specific DNA binding Source: InterPro
    2. sequence-specific DNA binding transcription factor activity Source: InterPro

    GO - Biological processi

    1. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Pituitary-specific positive transcription factor 1
    Short name:
    PIT-1
    Alternative name(s):
    Growth hormone factor 1
    Short name:
    GHF-1
    Gene namesi
    Name:POU1F1
    Synonyms:PIT1
    OrganismiMeleagris gallopavo (Common turkey)
    Taxonomic identifieri9103 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiTestudines + Archosauria groupArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalliformesPhasianidaeMeleagridinaeMeleagris
    ProteomesiUP000001645: Unplaced

    Subcellular locationi

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 370370Pituitary-specific positive transcription factor 1PRO_0000100704Add
    BLAST

    Expressioni

    Tissue specificityi

    Pituitary gland.

    Structurei

    3D structure databases

    ProteinModelPortaliQ05749.
    SMRiQ05749. Positions 207-351.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini202 – 27675POU-specificPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation
    Contains 1 POU-specific domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Homeobox

    Phylogenomic databases

    HOVERGENiHBG053120.

    Family and domain databases

    Gene3Di1.10.10.60. 1 hit.
    1.10.260.40. 1 hit.
    InterProiIPR017970. Homeobox_CS.
    IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    IPR010982. Lambda_DNA-bd_dom.
    IPR015586. Pit_1.
    IPR013847. POU.
    IPR000327. POU_specific.
    [Graphical view]
    PANTHERiPTHR11636:SF82. PTHR11636:SF82. 1 hit.
    PfamiPF00046. Homeobox. 1 hit.
    PF00157. Pou. 1 hit.
    [Graphical view]
    PRINTSiPR00028. POUDOMAIN.
    SMARTiSM00389. HOX. 1 hit.
    SM00352. POU. 1 hit.
    [Graphical view]
    SUPFAMiSSF46689. SSF46689. 1 hit.
    SSF47413. SSF47413. 1 hit.
    PROSITEiPS00027. HOMEOBOX_1. 1 hit.
    PS50071. HOMEOBOX_2. 1 hit.
    PS00035. POU_1. 1 hit.
    PS00465. POU_2. 1 hit.
    PS51179. POU_3. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform PIT-1beta* (identifier: Q05749-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTCQAFASSD NFVPLNSDSS PSLPLIMHHS AAECLPVSNH ATSVVSTVPS    50
    VLSLIQTPKC SHLHFAMMTS GNVSAGLHYS VPSCHYGNQT STYGVMTGIK 100
    PATPEMLSAS LSQSRILQTC SMPHPNVVNG VSTLQSKSFS FSCSLTPCLY 150
    KFPEHALSAS SCALGHSFTP MHQTLLSDDP TAADFKQEFR RKSKSVEEPV 200
    DMDSPEIREL EKFANEFKLR RIKLGYTQTN VGEALAAVHG SEFSQTTICR 250
    FENSQLSFKN ACKLKSILSK WLEEAEQVGA LYNEKVGVNE RKRKRRTTIS 300
    IAAKEALERH FGEQSKPSSQ EIMRMAEGLN LEKEVVRVWF CNRRQREKRV 350
    KTSLHQNAFS SIIKEHHECR 370
    Length:370
    Mass (Da):41,191
    Last modified:October 1, 1996 - v2
    Checksum:iAB2ABFCBE257C171
    GO
    Isoform PIT-1 (identifier: Q05749-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-47: MTCQAFASSDNFVPLNSDSSPSLPLIMHHSAAECLPVSNHATSVVST → MYLESSCVFLP

    Show »
    Length:334
    Mass (Da):37,577
    Checksum:i59380B169C5727B1
    GO
    Isoform PIT-1* (identifier: Q05749-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         48-75: Missing.

    Show »
    Length:342
    Mass (Da):38,252
    Checksum:iE5ED97A45197931B
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4747MTCQA…SVVST → MYLESSCVFLP in isoform PIT-1. CuratedVSP_002318Add
    BLAST
    Alternative sequencei48 – 7528Missing in isoform PIT-1*. CuratedVSP_002319Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U18928
    , U62732, U18923, U18924, U18925, U18926, U18927 Genomic DNA. Translation: AAB04690.1.
    U18928
    , U62732, U18923, U18924, U18925, U18926, U18927 Genomic DNA. Translation: AAB04691.1.
    U18928
    , U18923, U18924, U18925, U18926, U18927 Genomic DNA. Translation: AAB04692.1.
    X69471 mRNA. Translation: CAA49229.1. Sequence problems.
    PIRiS26693.
    UniGeneiMga.4351.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U18928
    , U62732 , U18923 , U18924 , U18925 , U18926 , U18927 Genomic DNA. Translation: AAB04690.1 .
    U18928
    , U62732 , U18923 , U18924 , U18925 , U18926 , U18927 Genomic DNA. Translation: AAB04691.1 .
    U18928
    , U18923 , U18924 , U18925 , U18926 , U18927 Genomic DNA. Translation: AAB04692.1 .
    X69471 mRNA. Translation: CAA49229.1 . Sequence problems.
    PIRi S26693.
    UniGenei Mga.4351.

    3D structure databases

    ProteinModelPortali Q05749.
    SMRi Q05749. Positions 207-351.
    ModBasei Search...
    MobiDBi Search...

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Phylogenomic databases

    HOVERGENi HBG053120.

    Family and domain databases

    Gene3Di 1.10.10.60. 1 hit.
    1.10.260.40. 1 hit.
    InterProi IPR017970. Homeobox_CS.
    IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    IPR010982. Lambda_DNA-bd_dom.
    IPR015586. Pit_1.
    IPR013847. POU.
    IPR000327. POU_specific.
    [Graphical view ]
    PANTHERi PTHR11636:SF82. PTHR11636:SF82. 1 hit.
    Pfami PF00046. Homeobox. 1 hit.
    PF00157. Pou. 1 hit.
    [Graphical view ]
    PRINTSi PR00028. POUDOMAIN.
    SMARTi SM00389. HOX. 1 hit.
    SM00352. POU. 1 hit.
    [Graphical view ]
    SUPFAMi SSF46689. SSF46689. 1 hit.
    SSF47413. SSF47413. 1 hit.
    PROSITEi PS00027. HOMEOBOX_1. 1 hit.
    PS50071. HOMEOBOX_2. 1 hit.
    PS00035. POU_1. 1 hit.
    PS00465. POU_2. 1 hit.
    PS51179. POU_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complementary DNA cloning and expression of Pit-1/GHF-1 from the domestic turkey."
      Wong E.A., Silsby J.L., el Halawani M.E.
      DNA Cell Biol. 11:651-660(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
      Tissue: Pituitary.
    2. Wong E.A., Sharova L., Kurima K., Weatherly K.L.
      Submitted (JAN-1995) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION, ALTERNATIVE SPLICING.

    Entry informationi

    Entry nameiPIT1_MELGA
    AccessioniPrimary (citable) accession number: Q05749
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1995
    Last sequence update: October 1, 1996
    Last modified: October 1, 2014
    This is version 95 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3