Q05655 (KPCD_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 149.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein kinase C delta type EC=2.7.11.13 Cleaved into the following 2 chains:
| ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 676 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays contrasting roles in cell death and cell survival by functioning as a pro-apoptotic protein during DNA damage-induced apoptosis, but acting as an anti-apoptotic protein during cytokine receptor-initiated cell death, is involved in tumor suppression as well as survival of several cancers, is required for oxygen radical production by NADPH oxidase and acts as positive or negative regulator in platelet functional responses. Upon DNA damage, activates the promoter of the death-promoting transcription factor BCLAF1/Btf to trigger BCLAF1-mediated p53/TP53 gene transcription and apoptosis. In response to oxidative stress, interact with and activate CHUK/IKKA in the nucleus, causing the phosphorylation of p53/TP53. In the case of ER stress or DNA damage-induced apoptosis, can form a complex with the tyrosine-protein kinase ABL1 which trigger apoptosis independently of p53/TP53. In cytosol can trigger apoptosis by activating MAPK11 or MAPK14, inhibiting AKT1 and decreasing the level of X-linked inhibitor of apoptosis protein (XIAP), whereas in nucleus induces apoptosis via the activation of MAPK8 or MAPK9. Upon ionizing radiation treatment, is required for the activation of the apoptosis regulators BAX and BAK, which trigger the mitochondrial cell death pathway. Can phosphorylate MCL1 and target it for degradation which is sufficient to trigger for BAX activation and apoptosis. Is required for the control of cell cycle progression both at G1/S and G2/M phases. Mediates phorbol 12-myristate 13-acetate (PMA)-induced inhibition of cell cycle progression at G1/S phase by up-regulating the CDK inhibitor CDKN1A/p21 and inhibiting the cyclin CCNA2 promoter activity. In response to UV irradiation can phosphorylate CDK1, which is important for the G2/M DNA damage checkpoint activation. Can protect glioma cells from the apoptosis induced by TNFSF10/TRAIL, probably by inducing increased phosphorylation and subsequent activation of AKT1. Is highly expressed in a number of cancer cells and promotes cell survival and resistance against chemotherapeutic drugs by inducing cyclin D1 (CCND1) and hyperphosphorylation of RB1, and via several pro-survival pathways, including NF-kappa-B, AKT1 and MAPK1/3 (ERK1/2). Can also act as tumor suppressor upon mitogenic stimulation with PMA or TPA. In N-formyl-methionyl-leucyl-phenylalanine (fMLP)-treated cells, is required for NCF1 (p47-phox) phosphorylation and activation of NADPH oxidase activity, and regulates TNF-elicited superoxide anion production in neutrophils, by direct phosphorylation and activation of NCF1 or indirectly through MAPK1/3 (ERK1/2) signaling pathways. May also play a role in the regulation of NADPH oxidase activity in eosinophil after stimulation with IL5, leukotriene B4 or PMA. In collagen-induced platelet aggregation, acts a negative regulator of filopodia formation and actin polymerization by interacting with and negatively regulating VASP phosphorylation. Downstream of PAR1, PAR4 and CD36/GP4 receptors, regulates differentially platelet dense granule secretion; acts as a positive regulator in PAR-mediated granule secretion, whereas it negatively regulates CD36/GP4-mediated granule release. Phosphorylates MUC1 in the C-terminal and regulates the interaction between MUC1 and beta-catenin. The catalytic subunit phosphorylates 14-3-3 proteins (YWHAB, YWHAZ and YWHAH) in a sphingosine-dependent fashion By similarity. Ref.9 Ref.12 Ref.14 Ref.15 Ref.22 Ref.25 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. |
| Enzyme regulation | Novel PKCs (PRKCD, PRKCE, PRKCH and PRKCQ) are calcium-insensitive, but activated by diacylglycerol (DAG) and phosphatidylserine. Three specific sites; Thr-507 (activation loop of the kinase domain), Ser-645 (turn motif) and Ser-664 (hydrophobic region), need to be phosphorylated for its full activation. Activated by caspase-3 (CASP3) cleavage during apoptosis. After cleavage, the pseudosubstrate motif in the regulatory subunit is released from the substrate recognition site of the catalytic subunit, which enables PRKCD to become constitutively activated. The catalytic subunit which displays properties of a sphingosine-dependent protein kinase is activated by D-erythro-sphingosine (Sph) or N,N-dimethyl-D-erythrosphingosine (DMS) or N,N,N-trimethyl-D-erythrosphingosine (TMS), but not by ceramide or Sph-1-P and is strongly inhibited by phosphatidylserine By similarity. |
| Subunit structure | Interacts with PDPK1 (via N-terminus region), RAD9A, CDCP1, MUC1 and VASP. Ref.11 Ref.12 Ref.13 Ref.15 Ref.34 |
| Subcellular location | Cytoplasm. Cytoplasm › perinuclear region. Nucleus. Endoplasmic reticulum. Mitochondrion. Cell membrane; Peripheral membrane protein Ref.14 Ref.17 Ref.18. |
| Domain | The C1 domain, containing the phorbol ester/DAG-type region 1 (C1A) and 2 (C1B), is the diacylglycerol sensor. The C2 domain is a non-calcium binding domain. It binds proteins containing phosphotyrosine in a sequence-specific manner. |
| Post-translational modification | Autophosphorylated and/or phosphorylated at Thr-507, within the activation loop; phosphorylation at Thr-507 is not a prerequisite for enzymatic activity. Autophosphorylated at Ser-299, Ser-302 and Ser-304. Upon TNFSF10/TRAIL treatment, phosphorylated at Tyr-155; phosphorylation is required for its translocation to the endoplasmic reticulum and cleavage by caspase-3. Phosphorylated at Tyr-313, Tyr-334 and Tyr-567; phosphorylation of Tyr-313 and Tyr-567 following thrombin stimulation potentiates its kinase activity. Phosphorylated by protein kinase PDPK1; phosphorylation is inhibited by the apoptotic C-terminus cleavage product of PKN2. Ref.11 Ref.14 Ref.16 Ref.17 Ref.25 Proteolytically cleaved into a catalytic subunit and a regulatory subunit by caspase-3 during apoptosis which results in kinase activation By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily. Contains 1 AGC-kinase C-terminal domain. Contains 1 C2 domain. Contains 2 phorbol-ester/DAG-type zinc fingers. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| FYN | P06241 | 4 | EBI-704279,EBI-515315 | |
| GAP43 | P17677 | 4 | EBI-704279,EBI-1267511 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q05655-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q05655-2) Also known as: PKCdeltaVIII; The sequence of this isoform differs from the canonical sequence as follows: 328-328: Q → QGEAGSIAPLRFLFPLRPKKGDCPPFHCQVRQ | ||||||
| Note: Antiapoptotic isoform, resistant to caspase-3 cleavage. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 676 | 676 | Protein kinase C delta type | PRO_0000055694 | ||||||||||||||||||||||||||||||||||||||
| Chain | 1 – 329 | 329 | Protein kinase C delta type regulatory subunit By similarity | PRO_0000421667 | ||||||||||||||||||||||||||||||||||||||
| Chain | 330 – 676 | 347 | Protein kinase C delta type catalytic subunit By similarity | PRO_0000421668 | ||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||
| Domain | 1 – 90 | 90 | C2 | |||||||||||||||||||||||||||||||||||||||
| Domain | 349 – 603 | 255 | Protein kinase | |||||||||||||||||||||||||||||||||||||||
| Domain | 604 – 675 | 72 | AGC-kinase C-terminal | |||||||||||||||||||||||||||||||||||||||
| Zinc finger | 158 – 208 | 51 | Phorbol-ester/DAG-type 1 | |||||||||||||||||||||||||||||||||||||||
| Zinc finger | 230 – 280 | 51 | Phorbol-ester/DAG-type 2 | |||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 355 – 363 | 9 | ATP By similarity | |||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||
| Active site | 473 | 1 | Proton acceptor By similarity | |||||||||||||||||||||||||||||||||||||||
| Binding site | 378 | 1 | ATP By similarity | |||||||||||||||||||||||||||||||||||||||
| Site | 48 | 1 | Interaction with phosphotyrosine-containing peptide | |||||||||||||||||||||||||||||||||||||||
| Site | 62 | 1 | Interaction with phosphotyrosine-containing peptide | |||||||||||||||||||||||||||||||||||||||
| Site | 67 | 1 | Interaction with phosphotyrosine-containing peptide | |||||||||||||||||||||||||||||||||||||||
| Site | 123 | 1 | Interaction with phosphotyrosine-containing peptide | |||||||||||||||||||||||||||||||||||||||
| Site | 329 – 330 | 2 | Cleavage; by caspase-3 By similarity | |||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 43 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 64 | 1 | Phosphotyrosine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 130 | 1 | Phosphoserine Ref.21 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 155 | 1 | Phosphotyrosine Ref.14 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 218 | 1 | Phosphothreonine Ref.23 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 299 | 1 | Phosphoserine; by autocatalysis Ref.17 Ref.20 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 302 | 1 | Phosphoserine; by autocatalysis Ref.17 Ref.21 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 304 | 1 | Phosphoserine; by autocatalysis Ref.17 Ref.21 Ref.28 Ref.32 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 307 | 1 | Phosphoserine Ref.21 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 313 | 1 | Phosphotyrosine Ref.16 Ref.20 Ref.23 Ref.24 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 334 | 1 | Phosphotyrosine; by SRC Probable | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 374 | 1 | Phosphotyrosine Ref.28 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 503 | 1 | Phosphoserine Ref.20 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 507 | 1 | Phosphothreonine; by autocatalysis Probable | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 567 | 1 | Phosphotyrosine Ref.16 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 645 | 1 | Phosphoserine Ref.25 Ref.28 Ref.32 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 654 | 1 | Phosphoserine Ref.20 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 658 | 1 | Phosphoserine Ref.20 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 664 | 1 | Phosphoserine Ref.20 Ref.21 Ref.23 Ref.24 Ref.28 | |||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 328 | 1 | Q → QGEAGSIAPLRFLFPLRPKK GDCPPFHCQVRQ in isoform 2. | VSP_043899 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 348 | 1 | N → S. Corresponds to variant rs33911937 [ dbSNP | Ensembl ]. | VAR_035347 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 375 | 1 | F → S. Ref.1 Corresponds to variant rs1056998 [ dbSNP | Ensembl ]. | VAR_006175 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 410 | 1 | L → F. Corresponds to variant rs34502209 [ dbSNP | Ensembl ]. | VAR_035348 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 483 | 1 | R → W. Corresponds to variant rs35891605 [ dbSNP | Ensembl ]. | VAR_046009 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 494 | 1 | M → V. Ref.8 | VAR_020610 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 593 | 1 | V → M. Ref.1 | VAR_006176 | ||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 299 | 1 | S → A: Loss of phosphorylation. Ref.17 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 507 | 1 | T → A: No effect on kinase activity. Ref.10 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 524 | 1 | K → R in BAG36031. Ref.2 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 533 | 1 | S → A no nucleotide entry Ref.8 | |||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1 – 13 | 13 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 20 – 23 | 4 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 27 – 38 | 12 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 41 – 45 | 5 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 58 – 62 | 5 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 68 – 76 | 9 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 79 – 87 | 9 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 88 – 96 | 9 | ||||||||||||||||||||||||||||||||||||||||
| Turn | 97 – 100 | 4 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 101 – 107 | 7 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 109 – 111 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 113 – 123 | 11 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 156 – 158 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 161 – 164 | 4 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 173 – 175 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 181 – 183 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 186 – 189 | 4 | ||||||||||||||||||||||||||||||||||||||||
| Turn | 190 – 192 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 202 | 3 | ||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular and biochemical characterization of a recombinant human PKC-delta family member." Aris J.P., Basta P.V., Holmes W.D., Ballas L.M., Moomaw C., Rankl N.B., Blobel G., Loomis C.R., Burns D.J. Biochim. Biophys. Acta 1174:171-181(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS SER-375 AND MET-593. Tissue: Liver. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin. |
| [5] | "Partial cDNA Sequence of human protein kinase C delta." Hug H. Submitted (MAR-1993) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-365 (ISOFORM 1). Tissue: Hippocampus. |
| [6] | "Functional analyses of mammalian protein kinase C isozymes in budding yeast and mammalian fibroblasts." Nomoto S., Watanabe Y., Ninomiya-Tsuji J., Yang L.-X., Kikuchi K., Hagiwara M., Hidaka H., Matsumoto K., Irie K. Genes Cells 2:601-614(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 51-676 (ISOFORM 1). |
| [7] | "Identification of a novel antiapoptotic human protein kinase C delta isoform, PKCdeltaVIII in NT2 cells." Jiang K., Apostolatos A.H., Ghansah T., Watson J.E., Vickers T., Cooper D.R., Epling-Burnette P.K., Patel N.A. Biochemistry 47:787-797(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 224-371 (ISOFORM 2). |
| [8] | "Identification of multiple, novel, protein kinase C-related gene products." Palmer R.H., Ridden J., Parker P.J. FEBS Lett. 356:5-8(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 432-533 (ISOFORM 1), VARIANT VAL-494. |
| [9] | "Regulation of human eosinophil NADPH oxidase activity: a central role for PKCdelta." Bankers-Fulbright J.L., Kita H., Gleich G.J., O'Grady S.M. J. Cell. Physiol. 189:306-315(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [10] | "Phosphorylation of the protein kinase C-theta activation loop and hydrophobic motif regulates its kinase activity, but only activation loop phosphorylation is critical to in vivo nuclear-factor-kappaB induction." Liu Y., Graham C., Li A., Fisher R.J., Shaw S. Biochem. J. 361:255-265(2002) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF THR-507. |
| [11] | "Regulation of both PDK1 and the phosphorylation of PKC-zeta and -delta by a C-terminal PRK2 fragment." Hodgkinson C.P., Sale G.J. Biochemistry 41:561-569(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PDPK1, PHOSPHORYLATION. |
| [12] | "Protein kinase C delta regulates function of the DF3/MUC1 carcinoma antigen in beta-catenin signaling." Ren J., Li Y., Kufe D. J. Biol. Chem. 277:17616-17622(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MUC1, FUNCTION. |
| [13] | "Protein kinase Cdelta is responsible for constitutive and DNA damage-induced phosphorylation of Rad9." Yoshida K., Wang H.-G., Miki Y., Kufe D. EMBO J. 22:1431-1441(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RAD9A. |
| [14] | "Roles of tyrosine phosphorylation and cleavage of protein kinase Cdelta in its protective effect against tumor necrosis factor-related apoptosis inducing ligand-induced apoptosis." Okhrimenko H., Lu W., Xiang C., Ju D., Blumberg P.M., Gomel R., Kazimirsky G., Brodie C. J. Biol. Chem. 280:23643-23652(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION AT TYR-155. |
| [15] | "PKCdelta regulates collagen-induced platelet aggregation through inhibition of VASP-mediated filopodia formation." Pula G., Schuh K., Nakayama K., Nakayama K.I., Walter U., Poole A.W. Blood 108:4035-4044(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PLATELET AGGREGATION, INTERACTION WITH VASP. |
| [16] | "Coincident regulation of PKCdelta in human platelets by phosphorylation of Tyr311 and Tyr565 and phospholipase C signalling." Hall K.J., Jones M.L., Poole A.W. Biochem. J. 406:501-509(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-313 AND TYR-567. |
| [17] | "Novel phosphorylation site markers of protein kinase C delta activation." Durgan J., Michael N., Totty N., Parker P.J. FEBS Lett. 581:3377-3381(2007) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, AUTOPHOSPHORYLATION, PHOSPHORYLATION AT SER-299; SER-302 AND SER-304, MUTAGENESIS OF SER-299. |
| [18] | "The localization of protein kinase Cdelta in different subcellular sites affects its proapoptotic and antiapoptotic functions and the activation of distinct downstream signaling pathways." Gomel R., Xiang C., Finniss S., Lee H.K., Lu W., Okhrimenko H., Brodie C. Mol. Cancer Res. 5:627-639(2007) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [19] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Platelet. |
| [20] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-299; TYR-313; SER-503; SER-654; SER-658 AND SER-664, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [21] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130; SER-302; SER-304; SER-307 AND SER-664, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [22] | "Lyn, PKC-delta, SHIP-1 interactions regulate GPVI-mediated platelet-dense granule secretion." Chari R., Kim S., Murugappan S., Sanjay A., Daniel J.L., Kunapuli S.P. Blood 114:3056-3063(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PLATELET RESPONSE. |
| [23] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-218; TYR-313 AND SER-664, MASS SPECTROMETRY. |
| [24] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-313 AND SER-664, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [25] | "Regulation of TNF-induced oxygen radical production in human neutrophils: role of delta-PKC." Kilpatrick L.E., Sun S., Li H., Vary T.C., Korchak H.M. J. Leukoc. Biol. 87:153-164(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF NCF1, PHOSPHORYLATION AT THR-507 AND SER-645. |
| [26] | "Protein kinase C delta (PKC delta): activation mechanisms and functions." Kikkawa U., Matsuzaki H., Yamamoto T. J. Biochem. 132:831-839(2002) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON FUNCTION. |
| [27] | "Diverse functions of protein kinase C isoforms in platelet activation and thrombus formation." Harper M.T., Poole A.W. J. Thromb. Haemost. 8:454-462(2010) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON FUNCTION. |
| [28] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-304; TYR-374; SER-645 AND SER-664, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [29] | "Two faces of protein kinase Cdelta: the contrasting roles of PKCdelta in cell survival and cell death." Basu A., Pal D. ScientificWorldJournal 10:2272-2284(2010) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON FUNCTION. |
| [30] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [31] | "PKC-delta and PKC-epsilon: Foes of the same family or strangers?" Duquesnes N., Lezoualc'h F., Crozatier B. J. Mol. Cell. Cardiol. 51:665-673(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON FUNCTION. |
| [32] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-304 AND SER-645, MASS SPECTROMETRY. |
| [33] | "Protein kinase cdelta in apoptosis: a brief overview." Zhao M., Xia L., Chen G.Q. Arch. Immunol. Ther. Exp. 60:361-372(2012) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [34] | "The C2 domain of PKCdelta is a phosphotyrosine binding domain." Benes C.H., Wu N., Elia A.E.H., Dharia T., Cantley L.C., Soltoff S.P. Cell 121:271-280(2005) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 1-123 IN COMPLEX WITH PHOSPHOTYROSINE-CONTAINING PEPTIDE, INTERACTION WITH CDCP1. |
| [35] | "Solution structure of the first phorbol esters/diacylglycerol binding domain of human protein kinase C, delta." RIKEN structural genomics initiative (RSGI) Submitted (APR-2008) to the PDB data bank Cited for: STRUCTURE BY NMR OF 149-218. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L07860 mRNA. Translation: AAA03176.1. L07861 mRNA. Translation: AAA03175.1. AK313216 mRNA. Translation: BAG36031.1. CH471055 Genomic DNA. Translation: EAW65279.1. BC043350 mRNA. Translation: AAH43350.1. Z22521 mRNA. Translation: CAA80249.1. D10495 mRNA. Translation: BAA01381.1. DQ516383 mRNA. Translation: ABF68960.1. | ||||||||||||||||||
| IPI | IPI00329236. IPI00887373. | ||||||||||||||||||
| PIR | S35704. | ||||||||||||||||||
| RefSeq | NP_006245.2. NM_006254.3. NP_997704.1. NM_212539.1. | ||||||||||||||||||
| UniGene | Hs.155342. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q05655. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-29954N. | ||||||||||||||||||
| IntAct | Q05655. 10 interactions. | ||||||||||||||||||
| MINT | MINT-1346366. | ||||||||||||||||||
| STRING | 9606.ENSP00000331602. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q05655. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 205371776. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q05655. | ||||||||||||||||||
| PRIDE | Q05655. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 5580. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000330452; ENSP00000331602; ENSG00000163932. ENST00000394729; ENSP00000378217; ENSG00000163932. | ||||||||||||||||||
| GeneID | 5580. | ||||||||||||||||||
| KEGG | hsa:5580. | ||||||||||||||||||
| UCSC | uc003dgl.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 5580. | ||||||||||||||||||
| GeneCards | GC03P053190. | ||||||||||||||||||
| HGNC | HGNC:9399. PRKCD. | ||||||||||||||||||
| HPA | CAB010469. CAB013225. HPA001863. HPA001890. | ||||||||||||||||||
| MIM | 176977. gene. | ||||||||||||||||||
| neXtProt | NX_Q05655. | ||||||||||||||||||
| PharmGKB | PA33763. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG0515. | ||||||||||||||||||
| HOGENOM | HOG000233022. | ||||||||||||||||||
| HOVERGEN | HBG108317. | ||||||||||||||||||
| InParanoid | Q05655. | ||||||||||||||||||
| KO | K06068. | ||||||||||||||||||
| OMA | GEDEAKF. | ||||||||||||||||||
| OrthoDB | EOG4M91QX. | ||||||||||||||||||
| PhylomeDB | Q05655. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BRENDA | 2.7.11.13. 2681. | ||||||||||||||||||
| Pathway_Interaction_DB | alphasynuclein_pathway. Alpha-synuclein signaling. ceramidepathway. Ceramide signaling pathway. endothelinpathway. Endothelins. hedgehog_glipathway. Hedgehog signaling events mediated by Gli proteins. ifngpathway. IFN-gamma pathway. igf1_pathway. IGF1 pathway. il6_7pathway. IL6-mediated signaling events. lysophospholipid_pathway. LPA receptor mediated events. pdgfrbpathway. PDGFR-beta signaling pathway. nfat_3pathway. Role of Calcineurin-dependent NFAT signaling in lymphocytes. syndecan_2_pathway. Syndecan-2-mediated signaling events. syndecan_4_pathway. Syndecan-4-mediated signaling events. txa2pathway. Thromboxane A2 receptor signaling. pi3kplctrkpathway. Trk receptor signaling mediated by PI3K and PLC-gamma. mapktrkpathway. Trk receptor signaling mediated by the MAPK pathway. | ||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_116125. Disease. REACT_21257. Metabolism of RNA. REACT_578. Apoptosis. REACT_604. Hemostasis. REACT_6900. Immune System. REACT_71. Gene Expression. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q05655. | ||||||||||||||||||
| Bgee | Q05655. | ||||||||||||||||||
| CleanEx | HS_PRKCD. | ||||||||||||||||||
| Genevestigator | Q05655. | ||||||||||||||||||
| GermOnline | ENSG00000163932. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR000961. AGC-kinase_C. IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR020454. DAG/PE-bd. IPR011009. Kinase-like_dom. IPR017892. Pkinase_C. IPR014376. Prot_kin_PKC_delta. IPR002219. Prot_Kinase_C-like_PE/DAG-bd. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] | ||||||||||||||||||
| Pfam | PF00130. C1_1. 2 hits. PF00069. Pkinase. 1 hit. PF00433. Pkinase_C. 1 hit. [Graphical view] | ||||||||||||||||||
| PIRSF | PIRSF000551. PKC_delta. 1 hit. | ||||||||||||||||||
| PRINTS | PR00008. DAGPEDOMAIN. | ||||||||||||||||||
| SMART | SM00109. C1. 2 hits. SM00239. C2. 1 hit. SM00133. S_TK_X. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF56112. Kinase_like. 1 hit. | ||||||||||||||||||
| PROSITE | PS51285. AGC_KINASE_CTER. 1 hit. PS50004. C2. False negative. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. PS00479. ZF_DAG_PE_1. 2 hits. PS50081. ZF_DAG_PE_2. 2 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| BindingDB | Q05655. | ||||||||||||||||||
| ChEMBL | CHEMBL2996. | ||||||||||||||||||
| ChiTaRS | PRKCD. human. | ||||||||||||||||||
| EvolutionaryTrace | Q05655. | ||||||||||||||||||
| GenomeRNAi | 5580. | ||||||||||||||||||
| NextBio | 21638. | ||||||||||||||||||
| PMAP-CutDB | Q05655. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | KPCD_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q05655 Secondary accession number(s): B0KZ81 Q86XJ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
