Q05397 (FAK1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 150.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Focal adhesion kinase 1 Short name=FADK 1 EC=2.7.10.2 Alternative name(s): Focal adhesion kinase-related nonkinase Short name=FRNK Protein phosphatase 1 regulatory subunit 71 Short name=PPP1R71 Protein-tyrosine kinase 2 p125FAK pp125FAK | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1052 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Non-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progression, cell proliferation and apoptosis. Required for early embryonic development and placenta development. Required for embryonic angiogenesis, normal cardiomyocyte migration and proliferation, and normal heart development. Regulates axon growth and neuronal cell migration, axon branching and synapse formation; required for normal development of the nervous system. Plays a role in osteogenesis and differentiation of osteoblasts. Functions in integrin signal transduction, but also in signaling downstream of numerous growth factor receptors, G-protein coupled receptors (GPCR), EPHA2, netrin receptors and LDL receptors. Forms multisubunit signaling complexes with SRC and SRC family members upon activation; this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and substrates. Regulates numerous signaling pathways. Promotes activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascade. Promotes activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling cascade. Promotes localized and transient activation of guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs), and thereby modulates the activity of Rho family GTPases. Signaling via CAS family members mediates activation of RAC1. Recruits the ubiquitin ligase MDM2 to P53/TP53 in the nucleus, and thereby regulates P53/TP53 activity, P53/TP53 ubiquitination and proteasomal degradation. Phosphorylates SRC; this increases SRC kinase activity. Phosphorylates ACTN1, ARHGEF7, GRB7, RET and WASL. Promotes phosphorylation of PXN and STAT1; most likely PXN and STAT1 are phosphorylated by a SRC family kinase that is recruited to autophosphorylated PTK2/FAK1, rather than by PTK2/FAK1 itself. Promotes phosphorylation of BCAR1; GIT2 and SHC1; this requires both SRC and PTK2/FAK1. Promotes phosphorylation of BMX and PIK3R1. Isoform 6 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Ref.9 Ref.10 Ref.11 Ref.14 Ref.15 Ref.18 Ref.22 Ref.24 Ref.25 Ref.26 Ref.29 Ref.30 Ref.31 Ref.37 Ref.39 Ref.43 Ref.44 Ref.47 Ref.50 Ref.52 Ref.54 |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. Ref.9 Ref.10 Ref.63 |
| Enzyme regulation | Subject to autoinhibition, mediated by interactions between the FERM domain and the kinase domain. Activated by autophosphorylation at Tyr-397. This promotes interaction with SRC and phosphorylation at Tyr-576 and Tyr-577 in the kinase activation loop. Phosphorylation at Tyr-576 and Tyr-577 is required for maximal kinase activity. Inhibited by TAC544, TAE226, PF-573,228 and PF-562,271. Ref.9 Ref.22 Ref.24 Ref.26 Ref.43 Ref.52 |
| Subunit structure | Interacts (via first Pro-rich region) with CAS family members (via SH3 domain), including BCAR1, BCAR3, CASS4 and NEDD9. Interacts with GIT1. Interacts with SORBS1. Interacts with RGNEF. Interacts with SHB. Interacts with PXN and TLN1. Interacts with STAT1. Interacts with DCC. Interacts with WASL. Interacts with ARHGEF7. Interacts with GRB2 and GRB7 By similarity. Component of a complex that contains at least FER, CTTN and PTK2/FAK1. Interacts with BMX. Interacts with TGFB1I1. Interacts with STEAP4. Interacts with ZFYVE21. Interacts with ESR1. Interacts with PIK3R1 or PIK3R2. Interacts with SRC, FGR, FLT4 and RET. Interacts with EPHA2 in resting cells; activation of EPHA2 recruits PTPN11, leading to dephosphorylation of PTK2/FAK1 and dissociation of the complex. Interacts with EPHA1 (kinase activity-dependent). Interacts with CD4; this interaction requires the presence of HIV-1 gp120. Interacts with PIAS1. Interacts with ARHGAP26 and SHC1. Interacts with RB1CC1; this inhibits PTK2/FAK1 activity and activation of downstream signaling pathways. Interacts with P53/TP53 and MDM2. Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.16 Ref.19 Ref.29 Ref.30 Ref.32 Ref.38 Ref.40 Ref.45 Ref.47 Ref.62 Ref.64 |
| Subcellular location | Cell junction › focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm › cell cortex. Cytoplasm › cytoskeleton. Cytoplasm › cytoskeleton › centrosome By similarity. Nucleus. Note: Constituent of focal adhesions. Detected at microtubules. Ref.9 Ref.16 Ref.30 Ref.31 Ref.64 |
| Tissue specificity | Detected in B and T lymphocytes. Isoform 1 and isoform 6 are detected in lung fibroblasts (at protein level). Ubiquitous. Ref.1 Ref.2 Ref.6 Ref.44 |
| Developmental stage | Isoform 6 is detected in cultured cells, immediately after seeding and before formation of focal adhesions (at protein level). Ref.21 |
| Domain | The Pro-rich regions interact with the SH3 domain of CAS family members, such as BCAR1 and NEDD9, and with the GTPase activating protein ARHGAP26. The carboxy-terminal region is the site of focal adhesion targeting (FAT) sequence which mediates the localization of FAK1 to focal adhesions. |
| Post-translational modification | Phosphorylated on tyrosine residues upon activation, e.g. upon integrin signaling. Tyr-397 is the major autophosphorylation site, but other kinases can also phosphorylate this residue. Phosphorylation at Tyr-397 promotes interaction with SRC and SRC family members, leading to phosphorylation at Tyr-576, Tyr-577 and at additional tyrosine residues. FGR promotes phosphorylation at Tyr-397 and Tyr-576. FER promotes phosphorylation at Tyr-577, Tyr-861 and Tyr-925, even when cells are not adherent. Tyr-397, Tyr-576 and Ser-722 are phosphorylated only when cells are adherent. Phosphorylation at Tyr-397 is important for interaction with BMX, PIK3R1 and SHC1. Phosphorylation at Tyr-925 is important for interaction with GRB2. Dephosphorylated by PTPN11; PTPN11 is recruited to PTK2 via EPHA2 (tyrosine phosphorylated). Microtubule-induced dephosphorylation at Tyr-397 is crucial for the induction of focal adhesion disassembly; this dephosphorylation could be catalyzed by PTPN11 and regulated by ZFYVE21. Ref.9 Ref.10 Ref.11 Ref.13 Ref.15 Ref.17 Ref.20 Ref.22 Ref.23 Ref.24 Ref.26 Ref.27 Ref.28 Ref.33 Ref.34 Ref.36 Ref.37 Ref.39 Ref.41 Ref.42 Ref.45 Ref.47 Ref.63 Sumoylated; this enhances autophosphorylation By similarity. |
| Involvement in disease | Note=Aberrant PTK2/FAK1 expression may play a role in cancer cell proliferation, migration and invasion, in tumor formation and metastasis. PTK2/FAK1 overexpression is seen in many types of cancer. Ref.11 Ref.22 Ref.24 Ref.26 Ref.39 Ref.43 Ref.50 Ref.52 Ref.54 |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. FAK subfamily. Contains 1 FERM domain. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| EPHA2 | P29317 | 3 | EBI-702142,EBI-702104 | |
| PXN | P49023 | 7 | EBI-702142,EBI-702209 | |
| SRC | P12931 | 3 | EBI-702142,EBI-621482 | |
| Tgfb1i1 | Q62219 | 3 | EBI-702142,EBI-642844 | From a different organism. |
| TNS3 | Q68CZ2 | 3 | EBI-702142,EBI-1220488 | |
| TP53 | P04637 | 11 | EBI-702142,EBI-366083 |
Alternative products
| This entry describes 6 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q05397-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q05397-2) The sequence of this isoform differs from the canonical sequence as follows: 1-181: Missing. 182-189: EMRGNALE → MSDYWVVG 472-472: A → ACHYTSLHWNWCRYISDPNVDACPDPRNAE 834-854: Missing. | ||||||
| Note: Phosphorylated on Tyr-688. | ||||||
| Isoform 3 (identifier: Q05397-3) The sequence of this isoform differs from the canonical sequence as follows: 1-181: Missing. 182-189: EMRGNALE → MSDYWVVG 472-472: A → ACHYTSLHWNWCRYISDPNVDACPDPRNAE 677-706: STILEEEKAQQEERMRMESRRQATVSWDSG → FQNPAQMLPASGRLPNQPCPERENYSFATF 707-1052: Missing. | ||||||
| Isoform 4 (identifier: Q05397-4) The sequence of this isoform differs from the canonical sequence as follows: 1-181: Missing. 182-189: EMRGNALE → MSDYWVVG 472-472: A → ACHYTSLHWNWCRYISDPNVDACPDPRNAE 579-583: ASKGK → GKKSG 584-1052: Missing. | ||||||
| Isoform 5 (identifier: Q05397-5) The sequence of this isoform differs from the canonical sequence as follows: 868-868: D → GKEEKNWAERN 903-903: K → KPWR | ||||||
| Isoform 6 (identifier: Q05397-6) Also known as: FRNK; The sequence of this isoform differs from the canonical sequence as follows: 1-692: Missing. | ||||||
| Note: Produced by alternative promoter usage. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 1052 | 1051 | Focal adhesion kinase 1 | PRO_0000088077 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 35 – 355 | 321 | FERM | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 422 – 680 | 259 | Protein kinase | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 428 – 434 | 7 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 500 – 502 | 3 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 707 – 1052 | 346 | Interaction with TGFB1I1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 912 – 1052 | 141 | Interaction with RGNEF By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 712 – 733 | 22 | Pro-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 863 – 913 | 51 | Pro-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 546 | 1 | Proton acceptor By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 454 | 1 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.5 Ref.35 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 5 | 1 | Phosphotyrosine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 13 | 1 | Phosphothreonine Ref.33 Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 16 | 1 | Phosphoserine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 29 | 1 | Phosphoserine Ref.33 Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 386 | 1 | Phosphothreonine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 390 | 1 | Phosphoserine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 392 | 1 | Phosphoserine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 394 | 1 | Phosphothreonine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 397 | 1 | Phosphotyrosine; by autocatalysis Ref.13 Ref.15 Ref.20 Ref.22 Ref.23 Ref.24 Ref.26 Ref.27 Ref.36 Ref.42 Ref.45 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 406 | 1 | Phosphothreonine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 407 | 1 | Phosphotyrosine Ref.13 Ref.15 Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 568 | 1 | Phosphoserine Ref.33 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 570 | 1 | Phosphotyrosine Ref.23 Ref.33 Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 575 | 1 | Phosphothreonine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 576 | 1 | Phosphotyrosine; by RET and SRC Ref.15 Ref.17 Ref.23 Ref.27 Ref.28 Ref.36 Ref.41 Ref.42 Ref.47 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 577 | 1 | Phosphotyrosine; by RET and SRC Ref.13 Ref.23 Ref.36 Ref.41 Ref.42 Ref.47 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 580 | 1 | Phosphoserine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 677 | 1 | Phosphoserine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 700 | 1 | Phosphothreonine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 702 | 1 | Phosphoserine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 705 | 1 | Phosphoserine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 708 | 1 | Phosphoserine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 716 | 1 | Phosphoserine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 720 | 1 | Phosphotyrosine Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 722 | 1 | Phosphoserine Ref.27 Ref.33 Ref.36 Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 732 | 1 | Phosphoserine; by CDK5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 840 | 1 | Phosphoserine Ref.20 Ref.27 Ref.33 Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 843 | 1 | Phosphoserine Ref.27 Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 861 | 1 | Phosphotyrosine Ref.13 Ref.22 Ref.23 Ref.36 Ref.41 Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 887 | 1 | Phosphoserine Ref.33 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 910 | 1 | Phosphoserine Ref.27 Ref.33 Ref.34 Ref.42 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 925 | 1 | Phosphotyrosine Ref.13 Ref.36 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 152 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 692 | 692 | Missing in isoform 6. | VSP_042168 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 181 | 181 | Missing in isoform 2, isoform 3 and isoform 4. | VSP_004967 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 182 – 189 | 8 | EMRGNALE → MSDYWVVG in isoform 2, isoform 3 and isoform 4. | VSP_004968 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 472 | 1 | A → ACHYTSLHWNWCRYISDPNV DACPDPRNAE in isoform 2, isoform 3 and isoform 4. | VSP_004969 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 579 – 583 | 5 | ASKGK → GKKSG in isoform 4. | VSP_004971 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 584 – 1052 | 469 | Missing in isoform 4. | VSP_004972 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 677 – 706 | 30 | STILE…SWDSG → FQNPAQMLPASGRLPNQPCP ERENYSFATF in isoform 3. | VSP_004973 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 707 – 1052 | 346 | Missing in isoform 3. | VSP_004974 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 834 – 854 | 21 | Missing in isoform 2. | VSP_004970 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 868 | 1 | D → GKEEKNWAERN in isoform 5. | VSP_042169 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 903 | 1 | K → KPWR in isoform 5. | VSP_042170 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 292 | 1 | H → P. Ref.65 | VAR_041682 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 292 | 1 | H → Q. Ref.65 | VAR_041683 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 793 | 1 | V → A in a glioblastoma multiforme sample; somatic mutation. Ref.65 | VAR_041684 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1030 | 1 | D → E. Ref.65 | VAR_041685 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1044 | 1 | K → E in a metastatic melanoma sample; somatic mutation. Ref.65 | VAR_041686 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 397 | 1 | Y → F: Abolishes autophosphorylation. Abolishes interaction with SRC and activation of BMX. Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 928 | 1 | V → G: Loss of interaction with TGFB1I1. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 1034 | 1 | L → S: Loss of interaction with TGFB1I1. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 184 | 1 | R → L in BAG65198. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 211 | 1 | L → I in BAG65198. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 778 | 1 | P → S in AAA35819. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 419 – 421 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 422 – 430 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 432 – 441 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 449 – 455 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 457 – 460 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 462 – 476 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 486 – 490 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 492 – 494 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 496 – 500 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 507 – 513 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 514 – 517 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 520 – 539 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 549 – 551 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 552 – 556 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 559 – 562 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 586 – 588 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 591 – 596 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 601 – 616 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 622 – 625 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 628 – 630 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 631 – 636 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 649 – 658 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 663 – 665 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 669 – 685 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 915 – 917 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 923 – 942 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 947 – 949 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 950 – 971 | 22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 972 – 974 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 977 – 979 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 980 – 1006 | 27 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1007 – 1009 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1010 – 1012 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1013 – 1045 | 33 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human T and B lymphocytes express a structurally conserved focal adhesion kinase, pp125FAK." Whitney G.S., Chan P.Y., Blake J., Cosand W.L., Neubauer M.G., Aruffo A., Kanner S.B. DNA Cell Biol. 12:823-830(1993) [PubMed: 7692878] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: T-cell. |
| [2] | "Expression of an N-terminally truncated form of human focal adhesion kinase in brain." Andre E., Becker-Andre M. Biochem. Biophys. Res. Commun. 190:140-147(1993) [PubMed: 8422239] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), TISSUE SPECIFICITY. Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Tissue: Trachea. |
| [4] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Bienvenut W.V., Glen H., Brunton V.G., Frame M.C. Submitted (JUL-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-19; 192-199; 222-236; 243-252; 350-364; 414-419; 468-476; 562-569; 674-690; 798-811; 832-838; 904-933; 963-981; 989-1000 AND 1003-1042, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, MASS SPECTROMETRY. Tissue: Osteosarcoma. |
| [6] | "A survey of protein tyrosine kinase mRNAs expressed in normal human melanocytes." Lee S.-T., Strunk K.M., Spritz R.A. Oncogene 8:3403-3410(1993) [PubMed: 8247543] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 552-602, TISSUE SPECIFICITY. Tissue: Melanocyte. |
| [7] | "Cell adhesion kinase beta forms a complex with a new member, Hic-5, of proteins localized at focal adhesions." Matsuya M., Sasaki H., Aoto H., Mitaka T., Nagura K., Ohba T., Ishino M., Takahashi S., Suzuki R., Sasaki T. J. Biol. Chem. 273:1003-1014(1998) [PubMed: 9422762] [Abstract] Cited for: INTERACTION WITH TGFB1I1. |
| [8] | "Interaction of Hic-5, A senescence-related protein, with focal adhesion kinase." Fujita H., Kamiguchi K., Cho D., Shibanuma M., Morimoto C., Tachibana K. J. Biol. Chem. 273:26516-26521(1998) [PubMed: 9756887] [Abstract] Cited for: INTERACTION WITH TGFB1I1, MUTAGENESIS OF VAL-928 AND LEU-1034. |
| [9] | "Activation of EphA2 kinase suppresses integrin function and causes focal-adhesion-kinase dephosphorylation." Miao H., Burnett E., Kinch M., Simon E., Wang B. Nat. Cell Biol. 2:62-69(2000) [PubMed: 10655584] [Abstract] Cited for: FUNCTION IN PXN PHOSPHORYLATION; REGULATION OF CELL SHAPE AND MIGRATION, INTERACTION WITH EPHA2, AUTOPHOSPHORYLATION, CATALYTIC ACTIVITY, ENZYME REGULATION, DEPHOSPHORYLATION BY PTPN11, SUBCELLULAR LOCATION. |
| [10] | "Regulation of the PH-domain-containing tyrosine kinase Etk by focal adhesion kinase through the FERM domain." Chen R., Kim O., Li M., Xiong X., Guan J.L., Kung H.J., Chen H., Shimizu Y., Qiu Y. Nat. Cell Biol. 3:439-444(2001) [PubMed: 11331870] [Abstract] Cited for: FUNCTION IN CELL MIGRATION AND ACTIVATION OF BMX, CATALYTIC ACTIVITY, AUTOPHOSPHORYLATION, MUTAGENESIS OF TYR-397, INTERACTION WITH BMX. |
| [11] | "Focal adhesion kinase enhances signaling through the Shc/extracellular signal-regulated kinase pathway in anaplastic astrocytoma tumor biopsy samples." Hecker T.P., Grammer J.R., Gillespie G.Y., Stewart J. Jr., Gladson C.L. Cancer Res. 62:2699-2707(2002) [PubMed: 11980671] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF SHC1, AUTOPHOSPHORYLATION, INTERACTION WITH SHC1 AND SRC, ROLE IN DISEASE. |
| [12] | "Regulation of focal adhesion kinase by a novel protein inhibitor FIP200." Abbi S., Ueda H., Zheng C., Cooper L.A., Zhao J., Christopher R., Guan J.L. Mol. Biol. Cell 13:3178-3191(2002) [PubMed: 12221124] [Abstract] Cited for: INTERACTION WITH RB1CC1. |
| [13] | "Site-specific phosphorylation of platelet focal adhesion kinase by low-density lipoprotein." Relou I.A.M., Bax L.A.B., Van Rijn H.J.M., Akkerman J.-W.N. Biochem. J. 369:407-416(2003) [PubMed: 12387730] [Abstract] Cited for: PHOSPHORYLATION AT TYR-397; TYR-407; TYR-577; TYR-861 AND TYR-925, INTERACTION WITH FGR. |
| [14] | "Focal adhesion kinase is upstream of phosphatidylinositol 3-kinase/Akt in regulating fibroblast survival in response to contraction of type I collagen matrices via a beta 1 integrin viability signaling pathway." Xia H., Nho R.S., Kahm J., Kleidon J., Henke C.A. J. Biol. Chem. 279:33024-33034(2004) [PubMed: 15166238] [Abstract] Cited for: FUNCTION IN INTEGRIN SIGNALING; REGULATION OF APOPTOSIS; REGULATION OF CELL SHAPE AND ACTIVATION OF PHOSPHATIDYLINOSITOL KINASE AND AKT1 SIGNALING PATHWAY. |
| [15] | "The proto-oncogene Fgr regulates cell migration and this requires its plasma membrane localization." Continolo S., Baruzzi A., Majeed M., Caveggion E., Fumagalli L., Lowell C.A., Berton G. Exp. Cell Res. 302:253-269(2005) [PubMed: 15561106] [Abstract] Cited for: FUNCTION IN REGULATION OF CELL MIGRATION, PHOSPHORYLATION AT TYR-407; TYR-397 AND TYR-576. |
| [16] | "Direct interaction of the N-terminal domain of focal adhesion kinase with the N-terminal transactivation domain of p53." Golubovskaya V.M., Finch R., Cance W.G. J. Biol. Chem. 280:25008-25021(2005) [PubMed: 15855171] [Abstract] Cited for: INTERACTION WITH P53/TP53, SUBCELLULAR LOCATION. |
| [17] | "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules." Zhang Y., Wolf-Yadlin A., Ross P.L., Pappin D.J., Rush J., Lauffenburger D.A., White F.M. Mol. Cell. Proteomics 4:1240-1250(2005) [PubMed: 15951569] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-576, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [18] | "Microtubule-induced focal adhesion disassembly is mediated by dynamin and focal adhesion kinase." Ezratty E.J., Partridge M.A., Gundersen G.G. Nat. Cell Biol. 7:581-590(2005) [PubMed: 15895076] [Abstract] Cited for: FUNCTION IN FOCAL ADHESION DISASSEMBLY. |
| [19] | "Vascular endothelial growth factor receptor-3 and focal adhesion kinase bind and suppress apoptosis in breast cancer cells." Garces C.A., Kurenova E.V., Golubovskaya V.M., Cance W.G. Cancer Res. 66:1446-1454(2006) [PubMed: 16452200] [Abstract] Cited for: INTERACTION WITH FLT4. |
| [20] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-397 AND SER-840, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [21] | "Expression of FAK-related non-kinase (FRNK) coincides with morphological change in the early stage of cell adhesion." Nagoshi Y., Yamamoto G., Irie T., Tachikawa T. Med. Mol. Morphol. 39:154-160(2006) [PubMed: 16998626] [Abstract] Cited for: ALTERNATIVE PROMOTER USAGE, IDENTIFICATION OF ISOFORM 6, DEVELOPMENTAL STAGE (ISOFORM 6). |
| [22] | "Therapeutic efficacy of a novel focal adhesion kinase inhibitor TAE226 in ovarian carcinoma." Halder J., Lin Y.G., Merritt W.M., Spannuth W.A., Nick A.M., Honda T., Kamat A.A., Han L.Y., Kim T.J., Lu C., Tari A.M., Bornmann W., Fernandez A., Lopez-Berestein G., Sood A.K. Cancer Res. 67:10976-10983(2007) [PubMed: 18006843] [Abstract] Cited for: ENZYME REGULATION, ROLE IN DISEASE, PHOSPHORYLATION AT TYR-397 AND TYR-861. |
| [23] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-397; TYR-570; TYR-576; TYR-577 AND TYR-861, MASS SPECTROMETRY. Tissue: Lung carcinoma. |
| [24] | "Cellular characterization of a novel focal adhesion kinase inhibitor." Slack-Davis J.K., Martin K.H., Tilghman R.W., Iwanicki M., Ung E.J., Autry C., Luzzio M.J., Cooper B., Kath J.C., Roberts W.G., Parsons J.T. J. Biol. Chem. 282:14845-14852(2007) [PubMed: 17395594] [Abstract] Cited for: FUNCTION, ENZYME REGULATION, ROLE IN DISEASE, PHOSPHORYLATION AT TYR-397. |
| [25] | "Activation of FAK is necessary for the osteogenic differentiation of human mesenchymal stem cells on laminin-5." Salasznyk R.M., Klees R.F., Boskey A., Plopper G.E. J. Cell. Biochem. 100:499-514(2007) [PubMed: 16927379] [Abstract] Cited for: FUNCTION IN OSTEOBLAST DIFFERENTIATION. |
| [26] | "Inhibition of both focal adhesion kinase and insulin-like growth factor-I receptor kinase suppresses glioma proliferation in vitro and in vivo." Liu T.J., LaFortune T., Honda T., Ohmori O., Hatakeyama S., Meyer T., Jackson D., de Groot J., Yung W.K. Mol. Cancer Ther. 6:1357-1367(2007) [PubMed: 17431114] [Abstract] Cited for: FUNCTION, ENZYME REGULATION, ROLE IN DISEASE, PHOSPHORYLATION AT TYR-397. |
| [27] | "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." Wissing J., Jaensch L., Nimtz M., Dieterich G., Hornberger R., Keri G., Wehland J., Daub H. Mol. Cell. Proteomics 6:537-547(2007) [PubMed: 17192257] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-397; TYR-576; SER-722; SER-840; SER-843 AND SER-910, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [28] | "Multiple reaction monitoring for robust quantitative proteomic analysis of cellular signaling networks." Wolf-Yadlin A., Hautaniemi S., Lauffenburger D.A., White F.M. Proc. Natl. Acad. Sci. U.S.A. 104:5860-5865(2007) [PubMed: 17389395] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-576, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [29] | "Etk/BMX, a Btk family tyrosine kinase, and Mal contribute to the cross-talk between MyD88 and FAK pathways." Semaan N., Alsaleh G., Gottenberg J.E., Wachsmann D., Sibilia J. J. Immunol. 180:3485-3491(2008) [PubMed: 18292575] [Abstract] Cited for: FUNCTION, INTERACTION WITH BMX. |
| [30] | "A novel Cas family member, HEPL, regulates FAK and cell spreading." Singh M.K., Dadke D., Nicolas E., Serebriiskii I.G., Apostolou S., Canutescu A., Egleston B.L., Golemis E.A. Mol. Biol. Cell 19:1627-1636(2008) [PubMed: 18256281] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH CASS4. |
| [31] | "Nuclear FAK promotes cell proliferation and survival through FERM-enhanced p53 degradation." Lim S.T., Chen X.L., Lim Y., Hanson D.A., Vo T.T., Howerton K., Larocque N., Fisher S.J., Schlaepfer D.D., Ilic D. Mol. Cell 29:9-22(2008) [PubMed: 18206965] [Abstract] Cited for: FUNCTION IN REGULATION OF P53/TP53 LEVELS; CELL PROLIFERATION AND CELL SURVIVAL, SUBCELLULAR LOCATION. |
| [32] | "Regulation of estrogen rapid signaling through arginine methylation by PRMT1." Le Romancer M., Treilleux I., Leconte N., Robin-Lespinasse Y., Sentis S., Bouchekioua-Bouzaghou K., Goddard S., Gobert-Gosse S., Corbo L. Mol. Cell 31:212-221(2008) [PubMed: 18657504] [Abstract] Cited for: INTERACTION WITH ESR1; PIK3R1 AND/OR PIK3R2 AND SRC. |
| [33] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-13; SER-29; SER-568; TYR-570; SER-722; SER-840; SER-887 AND SER-910, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [34] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [35] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [36] | "Specific tyrosine phosphorylation of focal adhesion kinase mediated by Fer tyrosine kinase in suspended hepatocytes." Oh M.A., Choi S., Lee M.J., Choi M.C., Lee S.A., Ko W., Cance W.G., Oh E.S., Buday L., Kim S.H., Lee J.W. Biochim. Biophys. Acta 1793:781-791(2009) [PubMed: 19339212] [Abstract] Cited for: PHOSPHORYLATION AT TYR-397; TYR-576; TYR-577; SER-722; TYR-861 AND TYR-925, IDENTIFICATION IN A COMPLEX WITH CTTN AND FER. |
| [37] | "Paxillin-Y118 phosphorylation contributes to the control of Src-induced anchorage-independent growth by FAK and adhesion." Sachdev S., Bu Y., Gelman I.H. BMC Cancer 9:12-12(2009) [PubMed: 19138410] [Abstract] Cited for: FUNCTION IN SRC-MEDIATED PHOSPHORYLATION OF PXN. |
| [38] | "STEAP4 regulates focal adhesion kinase activation and CpG motifs within STEAP4 promoter region are frequently methylated in DU145, human androgen-independent prostate cancer cells." Tamura T., Chiba J. Int. J. Mol. Med. 24:599-604(2009) [PubMed: 19787193] [Abstract] Cited for: INTERACTION WITH STEAP4. |
| [39] | "Ras- and PI3K-dependent breast tumorigenesis in mice and humans requires focal adhesion kinase signaling." Pylayeva Y., Gillen K.M., Gerald W., Beggs H.E., Reichardt L.F., Giancotti F.G. J. Clin. Invest. 119:252-266(2009) [PubMed: 19147981] [Abstract] Cited for: FUNCTION IN SRC-MEDIATED PHOSPHORYLATION OF BCAR1, ROLE IN DISEASE. |
| [40] | "EphA1 interacts with integrin-linked kinase and regulates cell morphology and motility." Yamazaki T., Masuda J., Omori T., Usui R., Akiyama H., Maru Y. J. Cell Sci. 122:243-255(2009) [PubMed: 19118217] [Abstract] Cited for: INTERACTION WITH EPHA1. |
| [41] | "An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells." Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A., Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D., Wiley H.S., Qian W.-J. J. Proteome Res. 8:3852-3861(2009) [PubMed: 19534553] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-576; TYR-577 AND TYR-861, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [42] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-5; THR-13; SER-16; SER-29; THR-386; SER-390; SER-392; THR-394; TYR-397; THR-406; TYR-407; TYR-570; THR-575; TYR-576; TYR-577; SER-580; SER-677; THR-700; SER-702; SER-705; SER-708; SER-716; TYR-720; SER-722; SER-840; SER-843; TYR-861 AND SER-910, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-688 (ISOFORM 2), MASS SPECTROMETRY. |
| [43] | "Bioluminescent imaging study: FAK inhibitor, PF-562,271, preclinical study in PC3M-luc-C6 local implant and metastasis xenograft models." Sun H., Pisle S., Gardner E.R., Figg W.D. Cancer Biol. Ther. 10:38-43(2010) [PubMed: 20495381] [Abstract] Cited for: ROLE IN DISEASE, ENZYME REGULATION. |
| [44] | "Downregulation of FAK-related non-kinase mediates the migratory phenotype of human fibrotic lung fibroblasts." Cai G.Q., Zheng A., Tang Q., White E.S., Chou C.F., Gladson C.L., Olman M.A., Ding Q. Exp. Cell Res. 316:1600-1609(2010) [PubMed: 20109444] [Abstract] Cited for: FUNCTION (ISOFORM 6), TISSUE SPECIFICITY. |
| [45] | "ZF21 protein regulates cell adhesion and motility." Nagano M., Hoshino D., Sakamoto T., Kawasaki N., Koshikawa N., Seiki M. J. Biol. Chem. 285:21013-21022(2010) [PubMed: 20439989] [Abstract] Cited for: INTERACTION WITH ZFYVE21, DEPHOSPHORYLATION AT TYR-397. |
| [46] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [47] | "Focal adhesion kinase (FAK) binds RET kinase via its FERM domain, priming a direct and reciprocal RET-FAK transactivation mechanism." Plaza-Menacho I., Morandi A., Mologni L., Boender P., Gambacorti-Passerini C., Magee A.I., Hofstra R.M.W., Knowles P., McDonald N.Q., Isacke C.M. J. Biol. Chem. 286:17292-17302(2011) [PubMed: 21454698] [Abstract] Cited for: INTERACTION WITH RET, FUNCTION IN RET PHOSPHORYLATION, PHOSPHORYLATION AT TYR-576 AND TYR-577. |
| [48] | "Signaling through focal adhesion kinase." Schlaepfer D.D., Hauck C.R., Sieg D.J. Prog. Biophys. Mol. Biol. 71:435-478(1999) [PubMed: 10354709] [Abstract] Cited for: REVIEW ON SIGNALING AND ON DIRECT PTK2/FAK1 SUBSTRATES. |
| [49] | "Netrin-integrin signaling in epithelial morphogenesis, axon guidance and vascular patterning." Nikolopoulos S.N., Giancotti F.G. Cell Cycle 4:E131-E135(2005) [PubMed: 15725728] [Abstract] Cited for: REVIEW ON FUNCTION IN NETRIN SIGNALING. |
| [50] | "Integrin-regulated FAK-Src signaling in normal and cancer cells." Mitra S.K., Schlaepfer D.D. Curr. Opin. Cell Biol. 18:516-523(2006) [PubMed: 16919435] [Abstract] Cited for: REVIEW ON FUNCTION IN CELL MIGRATION; FOCAL ADHESION TURNOVER AND ACTIVATION OF SIGNALING PATHWAYS, ROLE IN DISEASE. |
| [51] | "Focal adhesion kinase: an essential kinase in the regulation of cardiovascular functions." Vadali K., Cai X., Schaller M.D. IUBMB Life 59:709-716(2007) [PubMed: 17968709] [Abstract] Cited for: REVIEW ON FUNCTIONS IN THE CARDIOVASCULAR SYSTEM. |
| [52] | "FERM control of FAK function: implications for cancer therapy." Lim S.T., Mikolon D., Stupack D.G., Schlaepfer D.D. Cell Cycle 7:2306-2314(2008) [PubMed: 18677107] [Abstract] Cited for: REVIEW ON ROLE IN INTEGRIN SIGNALING AND IN REGULATION OF P53/TP53 ACTIVITIES, ROLE IN DISEASE, ENZYME REGULATION. |
| [53] | "Focal adhesion kinase: switching between GAPs and GEFs in the regulation of cell motility." Tomar A., Schlaepfer D.D. Curr. Opin. Cell Biol. 21:676-683(2009) [PubMed: 19525103] [Abstract] Cited for: REVIEW ON FUNCTION IN REGULATION OF RHO FAMILY GTPASE ACTIVITY. |
| [54] | "Focal adhesion kinase and cancer." Golubovskaya V.M., Kweh F.A., Cance W.G. Histol. Histopathol. 24:503-510(2009) [PubMed: 19224453] [Abstract] Cited for: REVIEW ON EXPRESSION IN CANCER, ROLE IN DISEASE. |
| [55] | "Focal adhesion kinase and p53 signal transduction pathways in cancer." Golubovskaya V.M., Cance W. Front. Biosci. 15:901-912(2010) [PubMed: 20515733] [Abstract] Cited for: REVIEW ON FUNCTION IN REGULATION OF P53/TP53. |
| [56] | "The role of focal adhesion kinase in early development." Chatzizacharias N.A., Kouraklis G.P., Theocharis S.E. Histol. Histopathol. 25:1039-1055(2010) [PubMed: 20552554] [Abstract] Cited for: REVIEW ON ROLE IN DEVELOPMENT. |
| [57] | "Integrin signaling through FAK in the regulation of mammary stem cells and breast cancer." Guan J.L. IUBMB Life 62:268-276(2010) [PubMed: 20101634] [Abstract] Cited for: REVIEW ON FUNCTION IN INTEGRIN SIGNALING AND ACTIVATION OF DOWNSTREAM SIGNALING PATHWAYS. |
| [58] | "Cellular functions of FAK kinases: insight into molecular mechanisms and novel functions." Schaller M.D. J. Cell Sci. 123:1007-1013(2010) [PubMed: 20332118] [Abstract] Cited for: REVIEW ON FUNCTION AND SIGNALING. |
| [59] | "Focal adhesion kinase: exploring Fak structure to gain insight into function." Hall J.E., Fu W., Schaller M.D. Int. Rev. Cell Mol. Biol. 288:185-225(2011) [PubMed: 21482413] [Abstract] Cited for: REVIEW ON FUNCTION; SUBUNIT; PHOSPHORYLATION; ENZYME REGULATION AND ROLE IN DISEASE. |
| [60] | "The structural basis of localization and signaling by the focal adhesion targeting domain." Arold S.T., Hoellerer M.K., Noble M.E. Structure 10:319-327(2002) [PubMed: 12005431] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) OF 891-1052, MASS SPECTROMETRY. |
| [61] | "Structures of the cancer-related Aurora-A, FAK, and EphA2 protein kinases from nanovolume crystallography." Nowakowski J., Cronin C.N., McRee D.E., Knuth M.W., Nelson C.G., Pavletich N.P., Rogers J., Sang B.C., Scheibe D.N., Swanson R.V., Thompson D.A. Structure 10:1659-1667(2002) [PubMed: 12467573] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.60 ANGSTROMS) OF 411-686 IN COMPLEX WITH ATP. |
| [62] | "Molecular recognition of paxillin LD motifs by the focal adhesion targeting domain." Hoellerer M.K., Noble M.E., Labesse G., Campbell I.D., Werner J.M., Arold S.T. Structure 11:1207-1217(2003) [PubMed: 14527389] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.35 ANGSTROMS) OF 892-1052 IN COMPLEX WITH PXN, INTERACTION WITH PXN. |
| [63] | "Antitumor activity and pharmacology of a selective focal adhesion kinase inhibitor, PF-562,271." Roberts W.G., Ung E., Whalen P., Cooper B., Hulford C., Autry C., Richter D., Emerson E., Lin J., Kath J., Coleman K., Yao L., Martinez-Alsina L., Lorenzen M., Berliner M., Luzzio M., Patel N., Schmitt E. Vajdos F.Cancer Res. 68:1935-1944(2008) [PubMed: 18339875] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.20 ANGSTROMS) OF 414-689 IN COMPLEX WITH INHIBITOR, CATALYTIC ACTIVITY, AUTOPHOSPHORYLATION. |
| [64] | "Structural basis for the interaction between focal adhesion kinase and CD4." Garron M.L., Arthos J., Guichou J.F., McNally J., Cicala C., Arold S.T. J. Mol. Biol. 375:1320-1328(2008) [PubMed: 18078954] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.82 ANGSTROMS) OF 891-1052 IN COMPLEX WITH CD4, SUBCELLULAR LOCATION, INTERACTION WITH CD4. |
| [65] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] PRO-292; GLN-292; ALA-793; GLU-1030 AND GLU-1044. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L13616 mRNA. Translation: AAA58469.1. L05186 mRNA. Translation: AAA35819.1. AK304356 mRNA. Translation: BAG65198.1. AC067931 Genomic DNA. No translation available. AC100860 Genomic DNA. No translation available. AC105009 Genomic DNA. No translation available. AC105235 Genomic DNA. No translation available. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00216217. IPI00216218. IPI00973349. IPI00982478. IPI01011193. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | I53012. PC1225. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_722560.1. NM_153831.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.395482. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | Q05397. Positions 33-686, 908-1049. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q05397. 16 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-92695. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 3183518. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000340930; ENSP00000341189; ENSG00000169398. ENST00000395218; ENSP00000378644; ENSG00000169398. ENST00000395223; ENSP00000378649; ENSG00000169398. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5747. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5747. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003yvt.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 5747. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC08M141737. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0020601. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:9611. PTK2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB004036. HPA001842. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 600758. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA33955. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG18315. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00600000084269. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG004018. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4WH8K1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 2.7.10.2. 2681. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | angiopoietinreceptor_pathway. Angiopoietin receptor Tie2-mediated signaling. caspase_pathway. Caspase cascade in apoptosis. epha2_fwdpathway. EPHA2 forward signaling. ephbfwdpathway. EPHB forward signaling. fcer1pathway. Fc-epsilon receptor I signaling in mast cells. igf1_pathway. IGF1 pathway. avb3_integrin_pathway. Integrins in angiogenesis. lysophospholipid_pathway. LPA receptor mediated events. a4b1_paxindep_pathway. Paxillin-independent events mediated by a4b1 and a4b7. met_pathway. Signaling events activated by Hepatocyte Growth Factor Receptor (c-Met). vegfr1_2_pathway. Signaling events mediated by VEGFR1 and VEGFR2. ret_pathway. Signaling events regulated by Ret tyrosine kinase. syndecan_4_pathway. Syndecan-4-mediated signaling events. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. REACT_111102. Signal Transduction. REACT_111155. Cell-Cell communication. REACT_578. Apoptosis. REACT_604. Hemostasis. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PTK2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000169398. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR019749. Band_41_domain. IPR014352. FERM/acyl-CoA-bd_prot_3-hlx. IPR019748. FERM_central. IPR000299. FERM_domain. IPR005189. Focal_adhesion_kin_target_dom. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase. IPR008266. Tyr_kinase_AS. IPR020635. Tyr_kinase_cat_dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.20.80.10. ACBP. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K05725. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00373. FERM_M. 1 hit. PF03623. Focal_AT. 1 hit. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00109. TYRKINASE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProDom | PD006413. Focal_adhesion_target_reg. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00295. B41. 1 hit. SM00219. TyrKc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF47031. FERM_3-hlx. 1 hit. SSF68993. Focal_AT. 1 hit. SSF56112. Kinase_like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00660. FERM_1. False negative. PS00661. FERM_2. 1 hit. PS50057. FERM_3. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 22380. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | FAK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q05397 Secondary accession number(s): B4E2N6 Q9UD85 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with