Reviewed,
UniProtKB/Swiss-Prot Q05397 (FAK1_HUMAN)
Last modified
July 7, 2009.
Version 118.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Focal adhesion kinase 1 Short name=FADK 1 EC=2.7.10.2 Alternative name(s): pp125FAK Protein-tyrosine kinase 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1052 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Non-receptor protein-tyrosine kinase implicated in signaling pathways involved in cell motility, proliferation and apoptosis. Activated by tyrosine-phosphorylation in response to either integrin clustering induced by cell adhesion or antibody cross-linking, or via G-protein coupled receptor (GPCR) occupancy by ligands such as bombesin or lysophosphatidic acid, or via LDL receptor occupancy. Plays a potential role in oncogenic transformations resulting in increased kinase activity. |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. |
| Subunit structure | Interacts with CAS family members and with GIT1, SORBS1 and BCAR3. Interacts with RGNEF and SHB By similarity. Interacts with TGFB1I1. |
| Subcellular location | Cell junction › focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note: Constituent of focal adhesions. |
| Tissue specificity | Expressed in all organs tested, in lymphoid cell lines, but most abundantly in brain. Ref.4 |
| Domain | The first Pro-rich domain interacts with the SH3 domain of CRK-associated substrate (BCAR1) and CASL By similarity. The carboxy-terminal region is the site of focal adhesion targeting (FAT) sequence which mediates the localization of FAK1 to focal adhesions. |
| Post-translational modification | Phosphorylated on 6 tyrosine residues upon activation. Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. FAK subfamily. Contains 1 FERM domain. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PXN | P49023 | 2 | EBI-702142,EBI-702209 | |
| RHOU | Q7L0Q8 | 1 | EBI-702142,EBI-1638043 | |
| SRC | P12931 | 1 | EBI-702142,EBI-621482 | |
| TGFB1I1 | O43294 | 1 | EBI-702142,EBI-1051449 | |
| Tgfb1i1 | Q62219 | 2 | EBI-702142,EBI-642844 | From a different organism. |
| TP53 | P04637 | 6 | EBI-702142,EBI-366083 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q05397-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q05397-2) The sequence of this isoform differs from the canonical sequence as follows: 1-181: Missing. 182-189: EMRGNALE → MSDYWVVG 472-472: A → ACHYTSLHWNWCRYISDPNVDACPDPRNAE 834-854: Missing. | ||||||
| Isoform 3 (identifier: Q05397-3) The sequence of this isoform differs from the canonical sequence as follows: 1-181: Missing. 182-189: EMRGNALE → MSDYWVVG 472-472: A → ACHYTSLHWNWCRYISDPNVDACPDPRNAE 677-706: STILEEEKAQQEERMRMESRRQATVSWDSG → FQNPAQMLPASGRLPNQPCPERENYSFATF 707-1052: Missing. | ||||||
| Isoform 4 (identifier: Q05397-4) The sequence of this isoform differs from the canonical sequence as follows: 1-181: Missing. 182-189: EMRGNALE → MSDYWVVG 472-472: A → ACHYTSLHWNWCRYISDPNVDACPDPRNAE 579-583: ASKGK → GKKSG 584-1052: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 1052 | 1051 | Focal adhesion kinase 1 | PRO_0000088077 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 35 – 355 | 321 | FERM | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 422 – 680 | 259 | Protein kinase | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 428 – 436 | 9 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 707 – 1052 | 346 | Interaction with TGFB1I1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 912 – 1052 | 141 | Interaction with RGNEF By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 712 – 733 | 22 | Pro-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 863 – 913 | 51 | Pro-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 546 | 1 | Proton acceptor By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 454 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 13 | 1 | Phosphothreonine Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 29 | 1 | Phosphoserine Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 397 | 1 | Phosphotyrosine Ref.7 Ref.9 Ref.10 Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 407 | 1 | Phosphotyrosine Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 568 | 1 | Phosphoserine Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 570 | 1 | Phosphotyrosine Ref.10 Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 576 | 1 | Phosphotyrosine; by autocatalysis Ref.8 Ref.10 Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 577 | 1 | Phosphotyrosine; by autocatalysis Ref.7 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 722 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 840 | 1 | Phosphoserine Ref.9 Ref.11 Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 843 | 1 | Phosphoserine Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 861 | 1 | Phosphotyrosine Ref.7 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 887 | 1 | Phosphoserine Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 910 | 1 | Phosphoserine Ref.11 Ref.12 Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 925 | 1 | Phosphotyrosine Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 181 | 181 | Missing in isoform 2, isoform 3 and isoform 4. | VSP_004967 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 182 – 189 | 8 | EMRGNALE → MSDYWVVG in isoform 2, isoform 3 and isoform 4. | VSP_004968 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 472 | 1 | A → ACHYTSLHWNWCRYISDPNV DACPDPRNAE in isoform 2, isoform 3 and isoform 4. | VSP_004969 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 579 – 583 | 5 | ASKGK → GKKSG in isoform 4. | VSP_004971 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 584 – 1052 | 469 | Missing in isoform 4. | VSP_004972 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 677 – 706 | 30 | STILE…SWDSG → FQNPAQMLPASGRLPNQPCP ERENYSFATF in isoform 3. | VSP_004973 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 707 – 1052 | 346 | Missing in isoform 3. | VSP_004974 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 834 – 854 | 21 | Missing in isoform 2. | VSP_004970 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 292 | 1 | H → P Ref.15 | VAR_041682 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 292 | 1 | H → Q Ref.15 | VAR_041683 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 793 | 1 | V → A in a glioblastoma multiforme sample; somatic mutation. Ref.15 | VAR_041684 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1030 | 1 | D → E Ref.15 | VAR_041685 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1044 | 1 | K → E in a metastatic melanoma sample; somatic mutation. Ref.15 | VAR_041686 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 928 | 1 | V → G: Loss of interaction with TGFB1I1. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 1034 | 1 | L → S: Loss of interaction with TGFB1I1. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 778 | 1 | P → S in AAA35819. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 419 – 421 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 422 – 430 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 432 – 441 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 449 – 455 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 457 – 460 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 462 – 476 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 486 – 490 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 492 – 494 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 496 – 500 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 507 – 513 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 514 – 517 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 520 – 539 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 549 – 551 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 552 – 556 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 559 – 562 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 586 – 588 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 591 – 596 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 601 – 616 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 622 – 625 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 628 – 630 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 631 – 636 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 649 – 658 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 663 – 665 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 669 – 685 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 915 – 917 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 923 – 942 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 947 – 949 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 950 – 971 | 22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 972 – 974 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 977 – 979 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 980 – 1006 | 27 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1007 – 1009 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1010 – 1012 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1013 – 1045 | 33 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human T and B lymphocytes express a structurally conserved focal adhesion kinase, pp125FAK." Whitney G.S., Chan P.Y., Blake J., Cosand W.L., Neubauer M.G., Aruffo A., Kanner S.B. DNA Cell Biol. 12:823-830(1993) [PubMed: 7692878] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: T-cell. |
| [2] | "Expression of an N-terminally truncated form of human focal adhesion kinase in brain." Andre E., Becker-Andre M. Biochem. Biophys. Res. Commun. 190:140-147(1993) [PubMed: 8422239] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4). Tissue: Brain. |
| [3] | Bienvenut W.V., Glen H., Brunton V.G., Frame M.C. Submitted (JUL-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-19; 192-199; 222-236; 243-252; 350-364; 414-419; 468-476; 562-569; 674-690; 798-811; 832-838; 904-933; 963-981; 989-1000 AND 1003-1042, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, MASS SPECTROMETRY. Tissue: Osteosarcoma. |
| [4] | "A survey of protein tyrosine kinase mRNAs expressed in normal human melanocytes." Lee S.-T., Strunk K.M., Spritz R.A. Oncogene 8:3403-3410(1993) [PubMed: 8247543] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 552-602, TISSUE SPECIFICITY. Tissue: Melanocyte. |
| [5] | "Cell adhesion kinase beta forms a complex with a new member, Hic-5, of proteins localized at focal adhesions." Matsuya M., Sasaki H., Aoto H., Mitaka T., Nagura K., Ohba T., Ishino M., Takahashi S., Suzuki R., Sasaki T. J. Biol. Chem. 273:1003-1014(1998) [PubMed: 9422762] [Abstract] Cited for: INTERACTION WITH TGFB1I1. |
| [6] | "Interaction of Hic-5, A senescence-related protein, with focal adhesion kinase." Fujita H., Kamiguchi K., Cho D., Shibanuma M., Morimoto C., Tachibana K. J. Biol. Chem. 273:26516-26521(1998) [PubMed: 9756887] [Abstract] Cited for: INTERACTION WITH TGFB1I1, MUTAGENESIS OF VAL-928 AND LEU-1034. |
| [7] | "Site-specific phosphorylation of platelet focal adhesion kinase by low-density lipoprotein." Relou I.A.M., Bax L.A.B., Van Rijn H.J.M., Akkerman J.-W.N. Biochem. J. 369:407-416(2003) [PubMed: 12387730] [Abstract] Cited for: PHOSPHORYLATION AT TYR-397; TYR-407; TYR-577; TYR-861 AND TYR-925. |
| [8] | "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules." Zhang Y., Wolf-Yadlin A., Ross P.L., Pappin D.J., Rush J., Lauffenburger D.A., White F.M. Mol. Cell. Proteomics 4:1240-1250(2005) [PubMed: 15951569] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-576, MASS SPECTROMETRY. Tissue: Epithelium. |
| [9] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-397 AND SER-840, MASS SPECTROMETRY. Tissue: Epithelium. |
| [10] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-397; TYR-570; TYR-576; TYR-577 AND TYR-861, MASS SPECTROMETRY. |
| [11] | "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." Wissing J., Jaensch L., Nimtz M., Dieterich G., Hornberger R., Keri G., Wehland J., Daub H. Mol. Cell. Proteomics 6:537-547(2007) [PubMed: 17192257] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-397; TYR-576; SER-722; SER-840; SER-843 AND SER-910, MASS SPECTROMETRY. |
| [12] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-13; SER-29; SER-568; TYR-570; SER-722; SER-840; SER-887 AND SER-910, MASS SPECTROMETRY. |
| [13] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910, MASS SPECTROMETRY. |
| [14] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [15] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] PRO-292; GLN-292; ALA-793; GLU-1030 AND GLU-1044. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| L13616 mRNA. Translation: AAA58469.1. L05186 mRNA. Translation: AAA35819.1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00012885. IPI00216217. IPI00216218. IPI00789953. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | I53012. PC1225. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_005598.3. NP_722560.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.395482 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | Q05397. Positions 33-383. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q05397. 13 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSG00000169398. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5747. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5747. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003yvt.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC08M141737. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0020601. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:9611. PTK2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB004036. HPA001842. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 600758. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA33955. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 2.7.10.2. 247. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | angiopoietinreceptor_pathway. Angiopoietin receptor Tie2-mediated signaling. caspase_pathway. Caspase cascade in apoptosis. epha2_fwdpathway. EPHA2 forward signaling. ephbfwdpathway. EPHB forward signaling. fcer1pathway. Fc-epsilon receptor I signaling in mast cells. igf1_pathway. IGF1 pathway. avb3_integrin_pathway. Integrins in angiogenesis. lysophospholipid_pathway. LPA receptor mediated events. a4b1_paxindep_pathway. Paxillin-independent events mediated by a4b1 and a4b7. met_pathway. Signaling events activated by Hepatocyte Growth Factor Receptor (c-Met). vegfr1_2_pathway. Signaling events mediated by VEGFR1 and VEGFR2. ret_pathway. Signaling events regulated by Ret tyrosine kinase. syndecan_4_pathway. Syndecan-4-mediated signaling events. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_13552. Integrin cell surface interactions. REACT_578. Apoptosis. REACT_604. Hemostasis. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PTK2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000169398. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR019749. Band_41_domain. IPR019748. FERM_central. IPR019747. FERM_CS. IPR000299. FERM_domain. IPR005189. Focal_adhesion_target_reg. IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR001245. Tyr_pkinase. IPR008266. Tyr_pkinase_AS. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00373. FERM_M. 1 hit. PF03623. Focal_AT. 1 hit. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00109. TYRKINASE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00295. B41. 1 hit. SM00219. TyrKc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00660. FERM_1. False negative. PS00661. FERM_2. 1 hit. PS50057. FERM_3. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 22380. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | Q05397. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | FAK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q05397 Secondary accession number(s): Q14291, Q9UD85 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


