Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q04941

- PLP2_HUMAN

UniProt

Q04941 - PLP2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Proteolipid protein 2

Gene

PLP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play a role in cell differentiation in the intestinal epithelium.

GO - Molecular functioni

  1. chemokine binding Source: UniProtKB
  2. ion transmembrane transporter activity Source: ProtInc

GO - Biological processi

  1. chemotaxis Source: UniProtKB
  2. cytokine-mediated signaling pathway Source: UniProtKB
  3. ion transmembrane transport Source: GOC
  4. ion transport Source: ProtInc
Complete GO annotation...

Protein family/group databases

TCDBi1.A.64.5.2. the plasmolipin (plasmolipin) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Proteolipid protein 2
Alternative name(s):
Differentiation-dependent protein A4
Intestinal membrane A4 protein
Gene namesi
Name:PLP2
Synonyms:A4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:9087. PLP2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei25 – 4521HelicalSequence AnalysisAdd
BLAST
Transmembranei48 – 6821HelicalSequence AnalysisAdd
BLAST
Transmembranei85 – 10521HelicalSequence AnalysisAdd
BLAST
Transmembranei112 – 13221HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum Source: ProtInc
  2. endoplasmic reticulum membrane Source: ProtInc
  3. extracellular vesicular exosome Source: UniProt
  4. integral component of membrane Source: UniProtKB-KW
  5. membrane Source: ProtInc
  6. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33415.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 152152Proteolipid protein 2PRO_0000156819Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi18 – 181N-linked (GlcNAc...)Sequence Analysis
Glycosylationi108 – 1081N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ04941.
PaxDbiQ04941.
PRIDEiQ04941.

PTM databases

PhosphoSiteiQ04941.

Expressioni

Tissue specificityi

Enriched in colonic mucosa. The expression of A4 follows a gradient along the crypto-villus axis with the most abundant message occurring in the lower half of the crypt.

Gene expression databases

BgeeiQ04941.
CleanExiHS_PLP2.
GenevestigatoriQ04941.

Organism-specific databases

HPAiHPA042415.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CCR1P322463EBI-608347,EBI-608322

Protein-protein interaction databases

BioGridi111369. 25 interactions.
IntActiQ04941. 4 interactions.
MINTiMINT-1394473.
STRINGi9606.ENSP00000365505.

Structurei

3D structure databases

ProteinModelPortaliQ04941.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini19 – 137119MARVELPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 MARVEL domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG296424.
GeneTreeiENSGT00530000063326.
HOGENOMiHOG000293179.
HOVERGENiHBG099247.
InParanoidiQ04941.
OMAiIYMCDLH.
OrthoDBiEOG7DNNXK.
PhylomeDBiQ04941.
TreeFamiTF317387.

Family and domain databases

InterProiIPR008253. Marvel.
[Graphical view]
PfamiPF01284. MARVEL. 1 hit.
[Graphical view]
PROSITEiPS51225. MARVEL. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q04941-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADSERLSAP GCWAACTNFS RTRKGILLFA EIILCLVILI CFSASTPGYS
60 70 80 90 100
SLSVIEMILA AIFFVVYMCD LHTKIPFINW PWSDFFRTLI AAILYLITSI
110 120 130 140 150
VVLVERGNHS KIVAGVLGLI ATCLFGYDAY VTFPVRQPRH TAAPTDPADG

PV
Length:152
Mass (Da):16,691
Last modified:October 1, 1993 - v1
Checksum:i689378A8C326206C
GO
Isoform 2 (identifier: Q04941-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-152: LGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV → KAMGAALKHRAKGLRSQGPFLPLLLAEIV

Show »
Length:145
Mass (Da):15,946
Checksum:i2E75CDC892EBF49D
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti91 – 911A → S.
Corresponds to variant rs1802969 [ dbSNP | Ensembl ].
VAR_011924

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei117 – 15236LGLIA…ADGPV → KAMGAALKHRAKGLRSQGPF LPLLLAEIV in isoform 2. 1 PublicationVSP_041602Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L09604 mRNA. Translation: AAA35499.1.
U93305 Genomic DNA. Translation: AAB92356.1.
DB102321 mRNA. No translation available.
AF196779 Genomic DNA. No translation available.
BC109066 mRNA. Translation: AAI09067.1.
CCDSiCCDS14319.1. [Q04941-1]
PIRiS32567.
RefSeqiNP_002659.1. NM_002668.2. [Q04941-1]
UniGeneiHs.77422.

Genome annotation databases

EnsembliENST00000376322; ENSP00000365500; ENSG00000102007. [Q04941-2]
ENST00000376327; ENSP00000365505; ENSG00000102007. [Q04941-1]
GeneIDi5355.
KEGGihsa:5355.
UCSCiuc004dmx.3. human. [Q04941-1]

Polymorphism databases

DMDMi416563.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L09604 mRNA. Translation: AAA35499.1 .
U93305 Genomic DNA. Translation: AAB92356.1 .
DB102321 mRNA. No translation available.
AF196779 Genomic DNA. No translation available.
BC109066 mRNA. Translation: AAI09067.1 .
CCDSi CCDS14319.1. [Q04941-1 ]
PIRi S32567.
RefSeqi NP_002659.1. NM_002668.2. [Q04941-1 ]
UniGenei Hs.77422.

3D structure databases

ProteinModelPortali Q04941.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111369. 25 interactions.
IntActi Q04941. 4 interactions.
MINTi MINT-1394473.
STRINGi 9606.ENSP00000365505.

Protein family/group databases

TCDBi 1.A.64.5.2. the plasmolipin (plasmolipin) family.

PTM databases

PhosphoSitei Q04941.

Polymorphism databases

DMDMi 416563.

Proteomic databases

MaxQBi Q04941.
PaxDbi Q04941.
PRIDEi Q04941.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000376322 ; ENSP00000365500 ; ENSG00000102007 . [Q04941-2 ]
ENST00000376327 ; ENSP00000365505 ; ENSG00000102007 . [Q04941-1 ]
GeneIDi 5355.
KEGGi hsa:5355.
UCSCi uc004dmx.3. human. [Q04941-1 ]

Organism-specific databases

CTDi 5355.
GeneCardsi GC0XP049037.
HGNCi HGNC:9087. PLP2.
HPAi HPA042415.
MIMi 300112. gene.
neXtProti NX_Q04941.
PharmGKBi PA33415.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG296424.
GeneTreei ENSGT00530000063326.
HOGENOMi HOG000293179.
HOVERGENi HBG099247.
InParanoidi Q04941.
OMAi IYMCDLH.
OrthoDBi EOG7DNNXK.
PhylomeDBi Q04941.
TreeFami TF317387.

Miscellaneous databases

ChiTaRSi PLP2. human.
GeneWikii PLP2.
GenomeRNAii 5355.
NextBioi 20758.
PROi Q04941.
SOURCEi Search...

Gene expression databases

Bgeei Q04941.
CleanExi HS_PLP2.
Genevestigatori Q04941.

Family and domain databases

InterProi IPR008253. Marvel.
[Graphical view ]
Pfami PF01284. MARVEL. 1 hit.
[Graphical view ]
PROSITEi PS51225. MARVEL. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and characterization of a differentiation-dependent gene in the human colonic cell line HT29-18."
    Oliva M.M., Wu T.-C., Yang V.W.
    Arch. Biochem. Biophys. 302:183-192(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
  2. "Sequence-based exon prediction around the synaptophysin locus reveals a gene-rich area containing novel genes in human proximal Xp."
    Fisher S.E., Ciccodicola A., Tanaka K., Curci A., Desicato S., D'Urso M., Craig I.W.
    Genomics 45:340-347(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Thymus.
  4. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPLP2_HUMAN
AccessioniPrimary (citable) accession number: Q04941
Secondary accession number(s): A6NDT7, Q32MM8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: October 29, 2014
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3