Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q04941

- PLP2_HUMAN

UniProt

Q04941 - PLP2_HUMAN

Protein

Proteolipid protein 2

Gene

PLP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    May play a role in cell differentiation in the intestinal epithelium.

    GO - Molecular functioni

    1. chemokine binding Source: UniProtKB
    2. ion transmembrane transporter activity Source: ProtInc
    3. protein binding Source: IntAct

    GO - Biological processi

    1. chemotaxis Source: UniProtKB
    2. cytokine-mediated signaling pathway Source: UniProtKB
    3. ion transmembrane transport Source: GOC
    4. ion transport Source: ProtInc

    Protein family/group databases

    TCDBi1.A.64.5.2. the plasmolipin (plasmolipin) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Proteolipid protein 2
    Alternative name(s):
    Differentiation-dependent protein A4
    Intestinal membrane A4 protein
    Gene namesi
    Name:PLP2
    Synonyms:A4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:9087. PLP2.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum Source: ProtInc
    2. endoplasmic reticulum membrane Source: ProtInc
    3. extracellular vesicular exosome Source: UniProt
    4. integral component of membrane Source: UniProtKB-KW
    5. membrane Source: ProtInc
    6. plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33415.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 152152Proteolipid protein 2PRO_0000156819Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi18 – 181N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi108 – 1081N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ04941.
    PaxDbiQ04941.
    PRIDEiQ04941.

    PTM databases

    PhosphoSiteiQ04941.

    Expressioni

    Tissue specificityi

    Enriched in colonic mucosa. The expression of A4 follows a gradient along the crypto-villus axis with the most abundant message occurring in the lower half of the crypt.

    Gene expression databases

    BgeeiQ04941.
    CleanExiHS_PLP2.
    GenevestigatoriQ04941.

    Organism-specific databases

    HPAiHPA042415.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CCR1P322463EBI-608347,EBI-608322

    Protein-protein interaction databases

    BioGridi111369. 23 interactions.
    IntActiQ04941. 4 interactions.
    MINTiMINT-1394473.
    STRINGi9606.ENSP00000365505.

    Structurei

    3D structure databases

    ProteinModelPortaliQ04941.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei25 – 4521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei48 – 6821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei85 – 10521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei112 – 13221HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini19 – 137119MARVELPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 MARVEL domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG296424.
    HOGENOMiHOG000293179.
    HOVERGENiHBG099247.
    InParanoidiQ04941.
    OMAiIYMCDLH.
    OrthoDBiEOG7DNNXK.
    PhylomeDBiQ04941.
    TreeFamiTF317387.

    Family and domain databases

    InterProiIPR008253. Marvel.
    [Graphical view]
    PfamiPF01284. MARVEL. 1 hit.
    [Graphical view]
    PROSITEiPS51225. MARVEL. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q04941-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MADSERLSAP GCWAACTNFS RTRKGILLFA EIILCLVILI CFSASTPGYS    50
    SLSVIEMILA AIFFVVYMCD LHTKIPFINW PWSDFFRTLI AAILYLITSI 100
    VVLVERGNHS KIVAGVLGLI ATCLFGYDAY VTFPVRQPRH TAAPTDPADG 150
    PV 152
    Length:152
    Mass (Da):16,691
    Last modified:October 1, 1993 - v1
    Checksum:i689378A8C326206C
    GO
    Isoform 2 (identifier: Q04941-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         117-152: LGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV → KAMGAALKHRAKGLRSQGPFLPLLLAEIV

    Show »
    Length:145
    Mass (Da):15,946
    Checksum:i2E75CDC892EBF49D
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti91 – 911A → S.
    Corresponds to variant rs1802969 [ dbSNP | Ensembl ].
    VAR_011924

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei117 – 15236LGLIA…ADGPV → KAMGAALKHRAKGLRSQGPF LPLLLAEIV in isoform 2. 1 PublicationVSP_041602Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L09604 mRNA. Translation: AAA35499.1.
    U93305 Genomic DNA. Translation: AAB92356.1.
    DB102321 mRNA. No translation available.
    AF196779 Genomic DNA. No translation available.
    BC109066 mRNA. Translation: AAI09067.1.
    CCDSiCCDS14319.1. [Q04941-1]
    PIRiS32567.
    RefSeqiNP_002659.1. NM_002668.2. [Q04941-1]
    UniGeneiHs.77422.

    Genome annotation databases

    EnsembliENST00000376322; ENSP00000365500; ENSG00000102007. [Q04941-2]
    ENST00000376327; ENSP00000365505; ENSG00000102007. [Q04941-1]
    GeneIDi5355.
    KEGGihsa:5355.
    UCSCiuc004dmx.3. human. [Q04941-1]

    Polymorphism databases

    DMDMi416563.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L09604 mRNA. Translation: AAA35499.1 .
    U93305 Genomic DNA. Translation: AAB92356.1 .
    DB102321 mRNA. No translation available.
    AF196779 Genomic DNA. No translation available.
    BC109066 mRNA. Translation: AAI09067.1 .
    CCDSi CCDS14319.1. [Q04941-1 ]
    PIRi S32567.
    RefSeqi NP_002659.1. NM_002668.2. [Q04941-1 ]
    UniGenei Hs.77422.

    3D structure databases

    ProteinModelPortali Q04941.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111369. 23 interactions.
    IntActi Q04941. 4 interactions.
    MINTi MINT-1394473.
    STRINGi 9606.ENSP00000365505.

    Protein family/group databases

    TCDBi 1.A.64.5.2. the plasmolipin (plasmolipin) family.

    PTM databases

    PhosphoSitei Q04941.

    Polymorphism databases

    DMDMi 416563.

    Proteomic databases

    MaxQBi Q04941.
    PaxDbi Q04941.
    PRIDEi Q04941.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000376322 ; ENSP00000365500 ; ENSG00000102007 . [Q04941-2 ]
    ENST00000376327 ; ENSP00000365505 ; ENSG00000102007 . [Q04941-1 ]
    GeneIDi 5355.
    KEGGi hsa:5355.
    UCSCi uc004dmx.3. human. [Q04941-1 ]

    Organism-specific databases

    CTDi 5355.
    GeneCardsi GC0XP049037.
    HGNCi HGNC:9087. PLP2.
    HPAi HPA042415.
    MIMi 300112. gene.
    neXtProti NX_Q04941.
    PharmGKBi PA33415.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG296424.
    HOGENOMi HOG000293179.
    HOVERGENi HBG099247.
    InParanoidi Q04941.
    OMAi IYMCDLH.
    OrthoDBi EOG7DNNXK.
    PhylomeDBi Q04941.
    TreeFami TF317387.

    Miscellaneous databases

    ChiTaRSi PLP2. human.
    GeneWikii PLP2.
    GenomeRNAii 5355.
    NextBioi 20758.
    PROi Q04941.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q04941.
    CleanExi HS_PLP2.
    Genevestigatori Q04941.

    Family and domain databases

    InterProi IPR008253. Marvel.
    [Graphical view ]
    Pfami PF01284. MARVEL. 1 hit.
    [Graphical view ]
    PROSITEi PS51225. MARVEL. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation and characterization of a differentiation-dependent gene in the human colonic cell line HT29-18."
      Oliva M.M., Wu T.-C., Yang V.W.
      Arch. Biochem. Biophys. 302:183-192(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    2. "Sequence-based exon prediction around the synaptophysin locus reveals a gene-rich area containing novel genes in human proximal Xp."
      Fisher S.E., Ciccodicola A., Tanaka K., Curci A., Desicato S., D'Urso M., Craig I.W.
      Genomics 45:340-347(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Thymus.
    4. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiPLP2_HUMAN
    AccessioniPrimary (citable) accession number: Q04941
    Secondary accession number(s): A6NDT7, Q32MM8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1993
    Last sequence update: October 1, 1993
    Last modified: October 1, 2014
    This is version 120 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3