Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q04941 (PLP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 115. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Proteolipid protein 2
Alternative name(s):
Differentiation-dependent protein A4
Intestinal membrane A4 protein
Gene names
Name:PLP2
Synonyms:A4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length152 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role in cell differentiation in the intestinal epithelium.

Subcellular location

Membrane; Multi-pass membrane protein.

Tissue specificity

Enriched in colonic mucosa. The expression of A4 follows a gradient along the crypto-villus axis with the most abundant message occurring in the lower half of the crypt.

Sequence similarities

Contains 1 MARVEL domain.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

CCR1P322463EBI-608347,EBI-608322

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q04941-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q04941-2)

The sequence of this isoform differs from the canonical sequence as follows:
     117-152: LGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV → KAMGAALKHRAKGLRSQGPFLPLLLAEIV

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 152152Proteolipid protein 2
PRO_0000156819

Regions

Transmembrane25 – 4521Helical; Potential
Transmembrane48 – 6821Helical; Potential
Transmembrane85 – 10521Helical; Potential
Transmembrane112 – 13221Helical; Potential
Domain19 – 137119MARVEL

Amino acid modifications

Glycosylation181N-linked (GlcNAc...) Potential
Glycosylation1081N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence117 – 15236LGLIA…ADGPV → KAMGAALKHRAKGLRSQGPF LPLLLAEIV in isoform 2.
VSP_041602
Natural variant911A → S.
Corresponds to variant rs1802969 [ dbSNP | Ensembl ].
VAR_011924

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 1993. Version 1.
Checksum: 689378A8C326206C

FASTA15216,691
        10         20         30         40         50         60 
MADSERLSAP GCWAACTNFS RTRKGILLFA EIILCLVILI CFSASTPGYS SLSVIEMILA 

        70         80         90        100        110        120 
AIFFVVYMCD LHTKIPFINW PWSDFFRTLI AAILYLITSI VVLVERGNHS KIVAGVLGLI 

       130        140        150 
ATCLFGYDAY VTFPVRQPRH TAAPTDPADG PV 

« Hide

Isoform 2 [UniParc].

Checksum: 2E75CDC892EBF49D
Show »

FASTA14515,946

References

« Hide 'large scale' references
[1]"Isolation and characterization of a differentiation-dependent gene in the human colonic cell line HT29-18."
Oliva M.M., Wu T.-C., Yang V.W.
Arch. Biochem. Biophys. 302:183-192(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
[2]"Sequence-based exon prediction around the synaptophysin locus reveals a gene-rich area containing novel genes in human proximal Xp."
Fisher S.E., Ciccodicola A., Tanaka K., Curci A., Desicato S., D'Urso M., Craig I.W.
Genomics 45:340-347(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[3]"Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes."
Kimura K., Wakamatsu A., Suzuki Y., Ota T., Nishikawa T., Yamashita R., Yamamoto J., Sekine M., Tsuritani K., Wakaguri H., Ishii S., Sugiyama T., Saito K., Isono Y., Irie R., Kushida N., Yoneyama T., Otsuka R. expand/collapse author list , Kanda K., Yokoi T., Kondo H., Wagatsuma M., Murakawa K., Ishida S., Ishibashi T., Takahashi-Fujii A., Tanase T., Nagai K., Kikuchi H., Nakai K., Isogai T., Sugano S.
Genome Res. 16:55-65(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Thymus.
[4]"The DNA sequence of the human X chromosome."
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. expand/collapse author list , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
[6]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L09604 mRNA. Translation: AAA35499.1.
U93305 Genomic DNA. Translation: AAB92356.1.
DB102321 mRNA. No translation available.
AF196779 Genomic DNA. No translation available.
BC109066 mRNA. Translation: AAI09067.1.
PIRS32567.
RefSeqNP_002659.1. NM_002668.2.
UniGeneHs.77422.

3D structure databases

ProteinModelPortalQ04941.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid111369. 23 interactions.
IntActQ04941. 4 interactions.
MINTMINT-1394473.
STRING9606.ENSP00000365505.

Protein family/group databases

TCDB1.A.64.5.2. the plasmolipin (plasmolipin) family.

PTM databases

PhosphoSiteQ04941.

Polymorphism databases

DMDM416563.

Proteomic databases

PaxDbQ04941.
PRIDEQ04941.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000376322; ENSP00000365500; ENSG00000102007. [Q04941-2]
ENST00000376327; ENSP00000365505; ENSG00000102007. [Q04941-1]
ENST00000595824; ENSP00000470766; ENSG00000269034. [Q04941-1]
ENST00000597997; ENSP00000472888; ENSG00000269034. [Q04941-2]
GeneID5355.
KEGGhsa:5355.
UCSCuc004dmx.3. human. [Q04941-1]

Organism-specific databases

CTD5355.
GeneCardsGC0XP049037.
HGNCHGNC:9087. PLP2.
HPAHPA042415.
MIM300112. gene.
neXtProtNX_Q04941.
PharmGKBPA33415.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG296424.
HOGENOMHOG000293179.
HOVERGENHBG099247.
InParanoidQ04941.
OMAIYMCDLH.
OrthoDBEOG7DNNXK.
PhylomeDBQ04941.
TreeFamTF317387.

Gene expression databases

BgeeQ04941.
CleanExHS_PLP2.
GenevestigatorQ04941.

Family and domain databases

InterProIPR008253. Marvel.
[Graphical view]
PfamPF01284. MARVEL. 1 hit.
[Graphical view]
PROSITEPS51225. MARVEL. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPLP2. human.
GeneWikiPLP2.
GenomeRNAi5355.
NextBio20758.
PROQ04941.
SOURCESearch...

Entry information

Entry namePLP2_HUMAN
AccessionPrimary (citable) accession number: Q04941
Secondary accession number(s): A6NDT7, Q32MM8
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: April 16, 2014
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM