Q04743 (EMX2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Homeobox protein EMX2 Alternative name(s): Empty spiracles homolog 2 Empty spiracles-like protein 2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 252 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system. |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Cerebral cortex. |
| Involvement in disease | Schizencephaly (SCHZC) [MIM:269160]: Extremely rare human congenital disorder characterized by a full-thickness cleft within the cerebral hemispheres. These clefts are lined with gray matter and most commonly involve the parasylvian regions. Large portions of the cerebral hemispheres may be absent and replaced by cerebro-spinal fluid. |
| Sequence similarities | Belongs to the EMX homeobox family. Contains 1 homeobox DNA-binding domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| EIF4E | P06730 | 4 | EBI-399831,EBI-73440 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q04743-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q04743-2) The sequence of this isoform differs from the canonical sequence as follows: 137-252: NDTSPESFLL...PEEIDVTSDD → KSMVSEPKNKVQKAEAGGRRLRFATKEKRDAPY |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 252 | 252 | Homeobox protein EMX2 | PRO_0000048868 | |||||
Regions | |||||||||
| DNA binding | 154 – 213 | 60 | Homeobox | ||||||
| Compositional bias | 54 – 59 | 6 | Poly-Ala | ||||||
Natural variations | |||||||||
| Alternative sequence | 137 – 252 | 116 | NDTSP…VTSDD → KSMVSEPKNKVQKAEAGGRR LRFATKEKRDAPY in isoform 2. | VSP_045823 | |||||
Experimental info | |||||||||
| Sequence conflict | 104 | 1 | S → P in BAB70842. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of the homeodomain gene EMX2: sequence conservation, expression analysis and a search for mutations in endometrial cancers." Noonan F.C., Mutch D.G., Mallon M., Goodfellow P.J. Genomics 76:37-44(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Amygdala. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Two vertebrate homeobox genes related to the Drosophila empty spiracles gene are expressed in the embryonic cerebral cortex." Simeone A., Gulisano M., Acampora D., Stornaiuolo A., Rambaldi M., Boncinelli E. EMBO J. 11:2541-2550(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 95-252 (ISOFORM 1). |
| [6] | "Germline mutations in the homeobox gene EMX2 in patients with severe schizencephaly." Brunelli S., Faiella A., Capra V., Nigro V., Simeone A., Cama A., Boncinelli E. Nat. Genet. 12:94-96(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN SCHZC. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF301598 mRNA. Translation: AAK95496.1. AL161811 mRNA. Translation: CAB82104.1. AK055041 mRNA. Translation: BAB70842.1. AC005871 Genomic DNA. No translation available. X68880 mRNA. Translation: CAA48751.1. |
| IPI | IPI00029166. |
| PIR | S22722. |
| RefSeq | NP_001159396.1. NM_001165924.1. NP_004089.1. NM_004098.3. |
| UniGene | Hs.202095. |
3D structure databases | |
| ProteinModelPortal | Q04743. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q04743. 1 interaction. |
| STRING | 9606.ENSP00000358202. |
PTM databases | |
| PhosphoSite | Q04743. |
Polymorphism databases | |
| DMDM | 19862512. |
Proteomic databases | |
| PaxDb | Q04743. |
| PRIDE | Q04743. |
Protocols and materials databases | |
| DNASU | 2018. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000369201; ENSP00000358202; ENSG00000170370. ENST00000553456; ENSP00000450962; ENSG00000170370. |
| GeneID | 2018. |
| KEGG | hsa:2018. |
| UCSC | uc001ldh.4. human. |
Organism-specific databases | |
| CTD | 2018. |
| GeneCards | GC10P119291. |
| HGNC | HGNC:3341. EMX2. |
| MIM | 269160. phenotype. 600035. gene. |
| neXtProt | NX_Q04743. |
| Orphanet | 799. Schizencephaly. |
| PharmGKB | PA27778. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG264928. |
| HOGENOM | HOG000247032. |
| HOVERGEN | HBG005024. |
| InParanoid | Q04743. |
| KO | K09317. |
| OMA | QMNPFLN. |
| OrthoDB | EOG4BP1CQ. |
| PhylomeDB | Q04743. |
Gene expression databases | |
| ArrayExpress | Q04743. |
| Bgee | Q04743. |
| CleanEx | HS_EMX2. |
| Genevestigator | Q04743. |
| GermOnline | ENSG00000170370. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.10.60. 1 hit. |
| InterPro | IPR017970. Homeobox_CS. IPR020479. Homeobox_metazoa. IPR001356. Homeodomain. IPR009057. Homeodomain-like. IPR000047. HTH_motif. [Graphical view] |
| Pfam | PF00046. Homeobox. 1 hit. [Graphical view] |
| PRINTS | PR00024. HOMEOBOX. PR00031. HTHREPRESSR. |
| SMART | SM00389. HOX. 1 hit. [Graphical view] |
| SUPFAM | SSF46689. Homeodomain_like. 1 hit. |
| PROSITE | PS00027. HOMEOBOX_1. 1 hit. PS50071. HOMEOBOX_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 2018. |
| NextBio | 8177. |
| SOURCE | Search... |
Entry information
| Entry name | EMX2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q04743 Secondary accession number(s): G3V305, Q96NN8, Q9BQF4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
