Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q04735

- CDK16_MOUSE

UniProt

Q04735 - CDK16_MOUSE

Protein

Cyclin-dependent kinase 16

Gene

Cdk16

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 137 (01 Oct 2014)
      Sequence version 1 (01 Oct 1993)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Protein kinase that plays a role in vesicle-mediated transport processes and exocytosis. Can phosphorylate CCNY at 'Ser-336' (in vitro) By similarity. Plays a role in the regulation of insulin secretion in response to changes in blood glucose levels. Regulates GH1 release by brain neurons. Phosphorylates NSF, and thereby regulates NSF oligomerization. Required for normal spermatogenesis. Regulates neuron differentiation and dendrite development.By similarity4 Publications

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.3 Publications

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei194 – 1941ATPPROSITE-ProRule annotation
    Active sitei286 – 2861Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi171 – 1799ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB-EC
    3. protein serine/threonine kinase activity Source: UniProtKB

    GO - Biological processi

    1. exocytosis Source: UniProtKB
    2. growth hormone secretion Source: UniProtKB
    3. neuron projection development Source: UniProtKB
    4. regulation of insulin secretion involved in cellular response to glucose stimulus Source: UniProtKB
    5. spermatogenesis Source: UniProtKB

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Biological processi

    Differentiation, Spermatogenesis

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDAi2.7.11.22. 3474.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cyclin-dependent kinase 16 (EC:2.7.11.22)
    Alternative name(s):
    CRK5
    Cell division protein kinase 16
    PCTAIRE-motif protein kinase 1
    Serine/threonine-protein kinase PCTAIRE-1
    Gene namesi
    Name:Cdk16
    Synonyms:Crk5, Pctaire1, Pctk1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome X

    Organism-specific databases

    MGIiMGI:97516. Cdk16.

    Subcellular locationi

    Cytoplasm By similarity. Cytoplasmic vesiclesecretory vesicle. Cell junctionsynapsesynaptosome
    Note: Colocalizes with insulin in pancreas islets.By similarity

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. extrinsic component of cytoplasmic side of plasma membrane Source: UniProtKB
    3. neuron projection Source: UniProtKB-SubCell
    4. synapse Source: UniProtKB-KW
    5. transport vesicle Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cytoplasm, Cytoplasmic vesicle, Synapse, Synaptosome

    Pathology & Biotechi

    Disruption phenotypei

    No visible phenotype in females; they are viable and fertile. Male mice are infertile, due to a defect in late stages of spermatogenesis.1 Publication

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi95 – 951S → A: Abolishes phosphorylation by CDK5. Impairs normal denrite development. 1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 496496Cyclin-dependent kinase 16PRO_0000086485Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei12 – 121Phosphoserine; by BRSK2By similarity
    Modified residuei42 – 421PhosphoserineBy similarity
    Modified residuei78 – 781PhosphoserineBy similarity
    Modified residuei82 – 821PhosphoserineBy similarity
    Modified residuei95 – 951Phosphoserine; by CDK51 Publication
    Modified residuei119 – 1191PhosphoserineBy similarity
    Modified residuei138 – 1381PhosphoserineBy similarity
    Modified residuei153 – 1531PhosphoserineBy similarity
    Modified residuei155 – 1551PhosphoserineBy similarity

    Post-translational modificationi

    Phosphorylation at Ser-153 inhibits kinase activity.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ04735.
    PaxDbiQ04735.
    PRIDEiQ04735.

    PTM databases

    PhosphoSiteiQ04735.

    Expressioni

    Tissue specificityi

    Highly expressed in testis and brain, and detected at lower levels in heart, skeletal muscle, adipose tissue, lung, spleen and pancreas (at protein level). Ubiquitous with highest levels in testis and brain, with longer form predominant in all tissues except the testis.3 Publications

    Gene expression databases

    BgeeiQ04735.
    CleanExiMM_PCTK1.
    GenevestigatoriQ04735.

    Interactioni

    Subunit structurei

    Found in a complex containing CABLES1, CDK17 and TDRD7. Interacts with BRSK2. Identified in a complex with NSF, syntaxin-1, synaptotagmin, SYN1, SYP and CDK5R1 By similarity. Interacts with YWHAH, YWHAQ and YWHAZ. Interacts with CCNY; this increases the CDK16 kinase activity. Interacts with NSF.By similarity4 Publications

    Structurei

    3D structure databases

    ProteinModelPortaliQ04735.
    SMRiQ04735. Positions 71-472.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini165 – 446282Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    HOGENOMiHOG000233024.
    HOVERGENiHBG014652.
    InParanoidiQ04735.
    KOiK08820.
    OMAiVAMDRMK.
    OrthoDBiEOG7966H8.
    PhylomeDBiQ04735.
    TreeFamiTF106508.

    Family and domain databases

    InterProiIPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view]
    PfamiPF00069. Pkinase. 1 hit.
    [Graphical view]
    SMARTiSM00220. S_TKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform Long (identifier: Q04735-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDRMKKIKRQ LSMTLRGGRG IDKTNGVPEQ IGLDESGGGG GSDLGEAPTR    50
    IAPGELRSVR GPLSSAPEIV HEDMKMGSDG ESDQASATSS DEVQSPVRVR 100
    MRNHPPRKIS TEDINKRLSL PADIRLPEGY LEKLTLNSPI FDKPLSRRLR 150
    RVSLSEIGFG KLETYIKLDK LGEGTYATVY KGKSKLTDNL VALKEIRLEH 200
    EEGAPCTAIR EVSLLKDLKH ANIVTLHDII HTEKSLTLVF EYLDKDLKQY 250
    LDDCGNVINM HNVKLFLFQL LRGLAYCHRQ KVLHRDLKPQ NLLINERGEL 300
    KLADFGLARA KSIPTKTYSN EVVTLWYRPP DILLGSTDYS TQIDMWGVGC 350
    IFYEMATGRP LFPGSTVEEQ LHFIFRILGT PTEETWPGIL SNEEFRTYNY 400
    PKYRAEALLS HAPRLDSDGA DLLTKLLQFE GRNRISAEDA RKHPFFLSLG 450
    ERIHKLPDTT SIFALKEVQL QKEANIRSTS MPDSGRPAFR VVDTEF 496
    Length:496
    Mass (Da):55,914
    Last modified:October 1, 1993 - v1
    Checksum:i0746036524B1FB5F
    GO
    Isoform Short (identifier: Q04735-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-66: Missing.
         67-67: P → MYTNGYDEEIYYIGGKRVFLTPKAWPFPLPTP

    Show »
    Length:461
    Mass (Da):52,718
    Checksum:i51AA256DB758DA34
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6666Missing in isoform Short. CuratedVSP_004801Add
    BLAST
    Alternative sequencei67 – 671P → MYTNGYDEEIYYIGGKRVFL TPKAWPFPLPTP in isoform Short. CuratedVSP_004802

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X69025 mRNA. Translation: CAA48787.1.
    BC011069 mRNA. Translation: AAH11069.1.
    X64606 mRNA. Translation: CAA45890.1.
    CCDSiCCDS30045.1. [Q04735-1]
    PIRiS30435.
    RefSeqiNP_035179.1. NM_011049.4. [Q04735-1]
    XP_006527633.1. XM_006527570.1. [Q04735-1]
    UniGeneiMm.102574.
    Mm.392081.

    Genome annotation databases

    EnsembliENSMUST00000033380; ENSMUSP00000033380; ENSMUSG00000031065. [Q04735-1]
    ENSMUST00000115364; ENSMUSP00000111021; ENSMUSG00000031065. [Q04735-2]
    GeneIDi18555.
    KEGGimmu:18555.
    UCSCiuc009sto.1. mouse. [Q04735-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X69025 mRNA. Translation: CAA48787.1 .
    BC011069 mRNA. Translation: AAH11069.1 .
    X64606 mRNA. Translation: CAA45890.1 .
    CCDSi CCDS30045.1. [Q04735-1 ]
    PIRi S30435.
    RefSeqi NP_035179.1. NM_011049.4. [Q04735-1 ]
    XP_006527633.1. XM_006527570.1. [Q04735-1 ]
    UniGenei Mm.102574.
    Mm.392081.

    3D structure databases

    ProteinModelPortali Q04735.
    SMRi Q04735. Positions 71-472.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q04735.

    Proteomic databases

    MaxQBi Q04735.
    PaxDbi Q04735.
    PRIDEi Q04735.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000033380 ; ENSMUSP00000033380 ; ENSMUSG00000031065 . [Q04735-1 ]
    ENSMUST00000115364 ; ENSMUSP00000111021 ; ENSMUSG00000031065 . [Q04735-2 ]
    GeneIDi 18555.
    KEGGi mmu:18555.
    UCSCi uc009sto.1. mouse. [Q04735-1 ]

    Organism-specific databases

    CTDi 5127.
    MGIi MGI:97516. Cdk16.

    Phylogenomic databases

    eggNOGi COG0515.
    HOGENOMi HOG000233024.
    HOVERGENi HBG014652.
    InParanoidi Q04735.
    KOi K08820.
    OMAi VAMDRMK.
    OrthoDBi EOG7966H8.
    PhylomeDBi Q04735.
    TreeFami TF106508.

    Enzyme and pathway databases

    BRENDAi 2.7.11.22. 3474.

    Miscellaneous databases

    ChiTaRSi CDK16. mouse.
    NextBioi 294376.
    PROi Q04735.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q04735.
    CleanExi MM_PCTK1.
    Genevestigatori Q04735.

    Family and domain databases

    InterProi IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view ]
    Pfami PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SMARTi SM00220. S_TKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "PCTAIRE-1 and PCTAIRE-3, two members of a novel cdc2/CDC28-related protein kinase gene family."
      Okuda T., Cleveland J.L., Downing J.R.
      Oncogene 7:2249-2258(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG).
      Tissue: Fibroblast.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG).
    3. "Novel CDC2-related protein kinases produced in murine hematopoietic stem cells."
      Ershler M.A., Nagorskaya T.V., Visser J.W.M., Belyavsky A.V.
      Gene 124:305-306(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 290-325.
      Strain: CBA.
      Tissue: Bone marrow.
    4. "The Cdk-like protein PCTAIRE-1 from mouse brain associates with p11 and 14-3-3 proteins."
      Sladeczek F., Camonis J.H., Burnol A.-F., Le Bouffant F.
      Mol. Gen. Genet. 254:571-577(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH YWHAH; YWHAQ AND YWHAZ.
    5. "Pctaire1 phosphorylates N-ethylmaleimide-sensitive fusion protein: implications in the regulation of its hexamerization and exocytosis."
      Liu Y., Cheng K., Gong K., Fu A.K., Ip N.Y.
      J. Biol. Chem. 281:9852-9858(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH NSF.
    6. "Cyclin-dependent kinase 5-dependent phosphorylation of Pctaire1 regulates dendrite development."
      Fu W.Y., Cheng K., Fu A.K., Ip N.Y.
      Neuroscience 180:353-359(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, MUTAGENESIS OF SER-95, PHOSPHORYLATION AT SER-95.
    7. "Analysis of substrate specificity and cyclin Y binding of PCTAIRE-1 kinase."
      Shehata S.N., Hunter R.W., Ohta E., Peggie M.W., Lou H.J., Sicheri F., Zeqiraj E., Turk B.E., Sakamoto K.
      Cell. Signal. 24:2085-2094(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: CATALYTIC ACTIVITY, INTERACTION WITH CCNY, TISSUE SPECIFICITY.
    8. "Brain-selective kinase 2 (BRSK2) phosphorylation on PCTAIRE1 negatively regulates glucose-stimulated insulin secretion in pancreatic beta-cells."
      Chen X.Y., Gu X.T., Saiyin H., Wan B., Zhang Y.J., Li J., Wang Y.L., Gao R., Wang Y.F., Dong W.P., Najjar S.M., Zhang C.Y., Ding H.F., Liu J.O., Yu L.
      J. Biol. Chem. 287:30368-30375(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    9. "Cyclin-dependent kinase 16/PCTAIRE kinase 1 is activated by cyclin Y and is essential for spermatogenesis."
      Mikolcevic P., Sigl R., Rauch V., Hess M.W., Pfaller K., Barisic M., Pelliniemi L.J., Boesl M., Geley S.
      Mol. Cell. Biol. 32:868-879(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISRUPTION PHENOTYPE, FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH CCNY, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiCDK16_MOUSE
    AccessioniPrimary (citable) accession number: Q04735
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1993
    Last sequence update: October 1, 1993
    Last modified: October 1, 2014
    This is version 137 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3