Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q04735

- CDK16_MOUSE

UniProt

Q04735 - CDK16_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cyclin-dependent kinase 16

Gene

Cdk16

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Protein kinase that plays a role in vesicle-mediated transport processes and exocytosis. Can phosphorylate CCNY at 'Ser-336' (in vitro) (By similarity). Plays a role in the regulation of insulin secretion in response to changes in blood glucose levels. Regulates GH1 release by brain neurons. Phosphorylates NSF, and thereby regulates NSF oligomerization. Required for normal spermatogenesis. Regulates neuron differentiation and dendrite development.By similarity4 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.3 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei194 – 1941ATPPROSITE-ProRule annotation
Active sitei286 – 2861Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi171 – 1799ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB-EC
  3. protein serine/threonine kinase activity Source: UniProtKB

GO - Biological processi

  1. exocytosis Source: UniProtKB
  2. growth hormone secretion Source: UniProtKB
  3. neuron projection development Source: UniProtKB
  4. regulation of insulin secretion involved in cellular response to glucose stimulus Source: UniProtKB
  5. spermatogenesis Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Differentiation, Spermatogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.22. 3474.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 16 (EC:2.7.11.22)
Alternative name(s):
CRK5
Cell division protein kinase 16
PCTAIRE-motif protein kinase 1
Serine/threonine-protein kinase PCTAIRE-1
Gene namesi
Name:Cdk16
Synonyms:Crk5, Pctaire1, Pctk1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome X

Organism-specific databases

MGIiMGI:97516. Cdk16.

Subcellular locationi

Cytoplasm By similarity. Cytoplasmic vesiclesecretory vesicle. Cell junctionsynapsesynaptosome
Note: Colocalizes with insulin in pancreas islets.By similarity

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. cytoplasmic vesicle Source: UniProtKB-KW
  3. extrinsic component of cytoplasmic side of plasma membrane Source: UniProtKB
  4. microtubule cytoskeleton Source: Ensembl
  5. neuron projection Source: UniProtKB-KW
  6. synapse Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoplasmic vesicle, Synapse, Synaptosome

Pathology & Biotechi

Disruption phenotypei

No visible phenotype in females; they are viable and fertile. Male mice are infertile, due to a defect in late stages of spermatogenesis.1 Publication

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi95 – 951S → A: Abolishes phosphorylation by CDK5. Impairs normal denrite development. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 496496Cyclin-dependent kinase 16PRO_0000086485Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei12 – 121Phosphoserine; by BRSK2By similarity
Modified residuei42 – 421PhosphoserineBy similarity
Modified residuei78 – 781PhosphoserineBy similarity
Modified residuei82 – 821PhosphoserineBy similarity
Modified residuei95 – 951Phosphoserine; by CDK51 Publication
Modified residuei119 – 1191PhosphoserineBy similarity
Modified residuei138 – 1381PhosphoserineBy similarity
Modified residuei153 – 1531PhosphoserineBy similarity
Modified residuei155 – 1551PhosphoserineBy similarity

Post-translational modificationi

Phosphorylation at Ser-153 inhibits kinase activity.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ04735.
PaxDbiQ04735.
PRIDEiQ04735.

PTM databases

PhosphoSiteiQ04735.

Expressioni

Tissue specificityi

Highly expressed in testis and brain, and detected at lower levels in heart, skeletal muscle, adipose tissue, lung, spleen and pancreas (at protein level). Ubiquitous with highest levels in testis and brain, with longer form predominant in all tissues except the testis.3 Publications

Gene expression databases

BgeeiQ04735.
CleanExiMM_PCTK1.
ExpressionAtlasiQ04735. baseline and differential.
GenevestigatoriQ04735.

Interactioni

Subunit structurei

Found in a complex containing CABLES1, CDK17 and TDRD7. Interacts with BRSK2. Identified in a complex with NSF, syntaxin-1, synaptotagmin, SYN1, SYP and CDK5R1 (By similarity). Interacts with YWHAH, YWHAQ and YWHAZ. Interacts with CCNY; this increases the CDK16 kinase activity. Interacts with NSF.By similarity4 Publications

Structurei

3D structure databases

ProteinModelPortaliQ04735.
SMRiQ04735. Positions 71-472.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini165 – 446282Protein kinasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0515.
HOGENOMiHOG000233024.
HOVERGENiHBG014652.
InParanoidiQ04735.
KOiK08820.
OMAiVAMDRMK.
OrthoDBiEOG7966H8.
PhylomeDBiQ04735.
TreeFamiTF106508.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform Long (identifier: Q04735-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRMKKIKRQ LSMTLRGGRG IDKTNGVPEQ IGLDESGGGG GSDLGEAPTR
60 70 80 90 100
IAPGELRSVR GPLSSAPEIV HEDMKMGSDG ESDQASATSS DEVQSPVRVR
110 120 130 140 150
MRNHPPRKIS TEDINKRLSL PADIRLPEGY LEKLTLNSPI FDKPLSRRLR
160 170 180 190 200
RVSLSEIGFG KLETYIKLDK LGEGTYATVY KGKSKLTDNL VALKEIRLEH
210 220 230 240 250
EEGAPCTAIR EVSLLKDLKH ANIVTLHDII HTEKSLTLVF EYLDKDLKQY
260 270 280 290 300
LDDCGNVINM HNVKLFLFQL LRGLAYCHRQ KVLHRDLKPQ NLLINERGEL
310 320 330 340 350
KLADFGLARA KSIPTKTYSN EVVTLWYRPP DILLGSTDYS TQIDMWGVGC
360 370 380 390 400
IFYEMATGRP LFPGSTVEEQ LHFIFRILGT PTEETWPGIL SNEEFRTYNY
410 420 430 440 450
PKYRAEALLS HAPRLDSDGA DLLTKLLQFE GRNRISAEDA RKHPFFLSLG
460 470 480 490
ERIHKLPDTT SIFALKEVQL QKEANIRSTS MPDSGRPAFR VVDTEF
Length:496
Mass (Da):55,914
Last modified:October 1, 1993 - v1
Checksum:i0746036524B1FB5F
GO
Isoform Short (identifier: Q04735-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.
     67-67: P → MYTNGYDEEIYYIGGKRVFLTPKAWPFPLPTP

Show »
Length:461
Mass (Da):52,718
Checksum:i51AA256DB758DA34
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6666Missing in isoform Short. CuratedVSP_004801Add
BLAST
Alternative sequencei67 – 671P → MYTNGYDEEIYYIGGKRVFL TPKAWPFPLPTP in isoform Short. CuratedVSP_004802

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X69025 mRNA. Translation: CAA48787.1.
BC011069 mRNA. Translation: AAH11069.1.
X64606 mRNA. Translation: CAA45890.1.
CCDSiCCDS30045.1. [Q04735-1]
PIRiS30435.
RefSeqiNP_035179.1. NM_011049.4. [Q04735-1]
XP_006527633.1. XM_006527570.1. [Q04735-1]
UniGeneiMm.102574.
Mm.392081.

Genome annotation databases

EnsembliENSMUST00000033380; ENSMUSP00000033380; ENSMUSG00000031065. [Q04735-1]
ENSMUST00000115364; ENSMUSP00000111021; ENSMUSG00000031065. [Q04735-2]
GeneIDi18555.
KEGGimmu:18555.
UCSCiuc009sto.1. mouse. [Q04735-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X69025 mRNA. Translation: CAA48787.1 .
BC011069 mRNA. Translation: AAH11069.1 .
X64606 mRNA. Translation: CAA45890.1 .
CCDSi CCDS30045.1. [Q04735-1 ]
PIRi S30435.
RefSeqi NP_035179.1. NM_011049.4. [Q04735-1 ]
XP_006527633.1. XM_006527570.1. [Q04735-1 ]
UniGenei Mm.102574.
Mm.392081.

3D structure databases

ProteinModelPortali Q04735.
SMRi Q04735. Positions 71-472.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q04735.

Proteomic databases

MaxQBi Q04735.
PaxDbi Q04735.
PRIDEi Q04735.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000033380 ; ENSMUSP00000033380 ; ENSMUSG00000031065 . [Q04735-1 ]
ENSMUST00000115364 ; ENSMUSP00000111021 ; ENSMUSG00000031065 . [Q04735-2 ]
GeneIDi 18555.
KEGGi mmu:18555.
UCSCi uc009sto.1. mouse. [Q04735-1 ]

Organism-specific databases

CTDi 5127.
MGIi MGI:97516. Cdk16.

Phylogenomic databases

eggNOGi COG0515.
HOGENOMi HOG000233024.
HOVERGENi HBG014652.
InParanoidi Q04735.
KOi K08820.
OMAi VAMDRMK.
OrthoDBi EOG7966H8.
PhylomeDBi Q04735.
TreeFami TF106508.

Enzyme and pathway databases

BRENDAi 2.7.11.22. 3474.

Miscellaneous databases

ChiTaRSi CDK16. mouse.
NextBioi 294376.
PROi Q04735.
SOURCEi Search...

Gene expression databases

Bgeei Q04735.
CleanExi MM_PCTK1.
ExpressionAtlasi Q04735. baseline and differential.
Genevestigatori Q04735.

Family and domain databases

InterProi IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF00069. Pkinase. 1 hit.
[Graphical view ]
SMARTi SM00220. S_TKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "PCTAIRE-1 and PCTAIRE-3, two members of a novel cdc2/CDC28-related protein kinase gene family."
    Okuda T., Cleveland J.L., Downing J.R.
    Oncogene 7:2249-2258(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG).
    Tissue: Fibroblast.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG).
  3. "Novel CDC2-related protein kinases produced in murine hematopoietic stem cells."
    Ershler M.A., Nagorskaya T.V., Visser J.W.M., Belyavsky A.V.
    Gene 124:305-306(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 290-325.
    Strain: CBA.
    Tissue: Bone marrow.
  4. "The Cdk-like protein PCTAIRE-1 from mouse brain associates with p11 and 14-3-3 proteins."
    Sladeczek F., Camonis J.H., Burnol A.-F., Le Bouffant F.
    Mol. Gen. Genet. 254:571-577(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH YWHAH; YWHAQ AND YWHAZ.
  5. "Pctaire1 phosphorylates N-ethylmaleimide-sensitive fusion protein: implications in the regulation of its hexamerization and exocytosis."
    Liu Y., Cheng K., Gong K., Fu A.K., Ip N.Y.
    J. Biol. Chem. 281:9852-9858(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH NSF.
  6. "Cyclin-dependent kinase 5-dependent phosphorylation of Pctaire1 regulates dendrite development."
    Fu W.Y., Cheng K., Fu A.K., Ip N.Y.
    Neuroscience 180:353-359(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF SER-95, PHOSPHORYLATION AT SER-95.
  7. "Analysis of substrate specificity and cyclin Y binding of PCTAIRE-1 kinase."
    Shehata S.N., Hunter R.W., Ohta E., Peggie M.W., Lou H.J., Sicheri F., Zeqiraj E., Turk B.E., Sakamoto K.
    Cell. Signal. 24:2085-2094(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: CATALYTIC ACTIVITY, INTERACTION WITH CCNY, TISSUE SPECIFICITY.
  8. "Brain-selective kinase 2 (BRSK2) phosphorylation on PCTAIRE1 negatively regulates glucose-stimulated insulin secretion in pancreatic beta-cells."
    Chen X.Y., Gu X.T., Saiyin H., Wan B., Zhang Y.J., Li J., Wang Y.L., Gao R., Wang Y.F., Dong W.P., Najjar S.M., Zhang C.Y., Ding H.F., Liu J.O., Yu L.
    J. Biol. Chem. 287:30368-30375(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  9. "Cyclin-dependent kinase 16/PCTAIRE kinase 1 is activated by cyclin Y and is essential for spermatogenesis."
    Mikolcevic P., Sigl R., Rauch V., Hess M.W., Pfaller K., Barisic M., Pelliniemi L.J., Boesl M., Geley S.
    Mol. Cell. Biol. 32:868-879(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISRUPTION PHENOTYPE, FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH CCNY, TISSUE SPECIFICITY.

Entry informationi

Entry nameiCDK16_MOUSE
AccessioniPrimary (citable) accession number: Q04735
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: October 29, 2014
This is version 138 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3