Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q04735 (CDK16_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 136. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cyclin-dependent kinase 16

EC=2.7.11.22
Alternative name(s):
CRK5
Cell division protein kinase 16
PCTAIRE-motif protein kinase 1
Serine/threonine-protein kinase PCTAIRE-1
Gene names
Name:Cdk16
Synonyms:Crk5, Pctaire1, Pctk1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length496 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Protein kinase that plays a role in vesicle-mediated transport processes and exocytosis. Can phosphorylate CCNY at 'Ser-336' (in vitro) By similarity. Plays a role in the regulation of insulin secretion in response to changes in blood glucose levels. Regulates GH1 release by brain neurons. Phosphorylates NSF, and thereby regulates NSF oligomerization. Required for normal spermatogenesis. Regulates neuron differentiation and dendrite development. Ref.5 Ref.6 Ref.8 Ref.9

Catalytic activity

ATP + a protein = ADP + a phosphoprotein. Ref.5 Ref.7 Ref.9

Subunit structure

Found in a complex containing CABLES1, CDK17 and TDRD7. Interacts with BRSK2. Identified in a complex with NSF, syntaxin-1, synaptotagmin, SYN1, SYP and CDK5R1 By similarity. Interacts with YWHAH, YWHAQ and YWHAZ. Interacts with CCNY; this increases the CDK16 kinase activity. Interacts with NSF. Ref.4 Ref.5 Ref.7 Ref.9

Subcellular location

Cytoplasm By similarity. Cytoplasmic vesiclesecretory vesicle. Cell junctionsynapsesynaptosome. Note: Colocalizes with insulin in pancreas islets By similarity.

Tissue specificity

Highly expressed in testis and brain, and detected at lower levels in heart, skeletal muscle, adipose tissue, lung, spleen and pancreas (at protein level). Ubiquitous with highest levels in testis and brain, with longer form predominant in all tissues except the testis. Ref.7 Ref.8 Ref.9

Post-translational modification

Phosphorylation at Ser-153 inhibits kinase activity By similarity.

Disruption phenotype

No visible phenotype in females; they are viable and fertile. Male mice are infertile, due to a defect in late stages of spermatogenesis. Ref.9

Sequence similarities

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

Contains 1 protein kinase domain.

Ontologies

Keywords
   Biological processDifferentiation
Spermatogenesis
   Cellular componentCell junction
Cytoplasm
Cytoplasmic vesicle
Synapse
Synaptosome
   Coding sequence diversityAlternative splicing
   LigandATP-binding
Nucleotide-binding
   Molecular functionKinase
Serine/threonine-protein kinase
Transferase
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processexocytosis

Inferred from mutant phenotype Ref.5. Source: UniProtKB

growth hormone secretion

Inferred from mutant phenotype Ref.5. Source: UniProtKB

neuron projection development

Inferred from mutant phenotype Ref.6. Source: UniProtKB

regulation of insulin secretion involved in cellular response to glucose stimulus

Inferred from mutant phenotype Ref.8. Source: UniProtKB

spermatogenesis

Inferred from mutant phenotype Ref.9. Source: UniProtKB

   Cellular_componentcell junction

Inferred from electronic annotation. Source: UniProtKB-KW

extrinsic component of cytoplasmic side of plasma membrane

Inferred from sequence or structural similarity. Source: UniProtKB

neuron projection

Inferred from electronic annotation. Source: UniProtKB-SubCell

synapse

Inferred from electronic annotation. Source: UniProtKB-KW

transport vesicle

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionATP binding

Inferred from electronic annotation. Source: UniProtKB-KW

cyclin-dependent protein serine/threonine kinase activity

Inferred from electronic annotation. Source: UniProtKB-EC

protein serine/threonine kinase activity

Inferred from mutant phenotype Ref.5. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform Long (identifier: Q04735-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Short (identifier: Q04735-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.
     67-67: P → MYTNGYDEEIYYIGGKRVFLTPKAWPFPLPTP

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 496496Cyclin-dependent kinase 16
PRO_0000086485

Regions

Domain165 – 446282Protein kinase
Nucleotide binding171 – 1799ATP By similarity

Sites

Active site2861Proton acceptor By similarity
Binding site1941ATP By similarity

Amino acid modifications

Modified residue121Phosphoserine; by BRSK2 By similarity
Modified residue421Phosphoserine By similarity
Modified residue781Phosphoserine By similarity
Modified residue821Phosphoserine By similarity
Modified residue951Phosphoserine; by CDK5 Ref.6
Modified residue1191Phosphoserine By similarity
Modified residue1381Phosphoserine By similarity
Modified residue1531Phosphoserine By similarity
Modified residue1551Phosphoserine By similarity

Natural variations

Alternative sequence1 – 6666Missing in isoform Short.
VSP_004801
Alternative sequence671P → MYTNGYDEEIYYIGGKRVFL TPKAWPFPLPTP in isoform Short.
VSP_004802

Experimental info

Mutagenesis951S → A: Abolishes phosphorylation by CDK5. Impairs normal denrite development. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform Long [UniParc].

Last modified October 1, 1993. Version 1.
Checksum: 0746036524B1FB5F

FASTA49655,914
        10         20         30         40         50         60 
MDRMKKIKRQ LSMTLRGGRG IDKTNGVPEQ IGLDESGGGG GSDLGEAPTR IAPGELRSVR 

        70         80         90        100        110        120 
GPLSSAPEIV HEDMKMGSDG ESDQASATSS DEVQSPVRVR MRNHPPRKIS TEDINKRLSL 

       130        140        150        160        170        180 
PADIRLPEGY LEKLTLNSPI FDKPLSRRLR RVSLSEIGFG KLETYIKLDK LGEGTYATVY 

       190        200        210        220        230        240 
KGKSKLTDNL VALKEIRLEH EEGAPCTAIR EVSLLKDLKH ANIVTLHDII HTEKSLTLVF 

       250        260        270        280        290        300 
EYLDKDLKQY LDDCGNVINM HNVKLFLFQL LRGLAYCHRQ KVLHRDLKPQ NLLINERGEL 

       310        320        330        340        350        360 
KLADFGLARA KSIPTKTYSN EVVTLWYRPP DILLGSTDYS TQIDMWGVGC IFYEMATGRP 

       370        380        390        400        410        420 
LFPGSTVEEQ LHFIFRILGT PTEETWPGIL SNEEFRTYNY PKYRAEALLS HAPRLDSDGA 

       430        440        450        460        470        480 
DLLTKLLQFE GRNRISAEDA RKHPFFLSLG ERIHKLPDTT SIFALKEVQL QKEANIRSTS 

       490 
MPDSGRPAFR VVDTEF 

« Hide

Isoform Short [UniParc].

Checksum: 51AA256DB758DA34
Show »

FASTA46152,718

References

« Hide 'large scale' references
[1]"PCTAIRE-1 and PCTAIRE-3, two members of a novel cdc2/CDC28-related protein kinase gene family."
Okuda T., Cleveland J.L., Downing J.R.
Oncogene 7:2249-2258(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG).
Tissue: Fibroblast.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG).
[3]"Novel CDC2-related protein kinases produced in murine hematopoietic stem cells."
Ershler M.A., Nagorskaya T.V., Visser J.W.M., Belyavsky A.V.
Gene 124:305-306(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 290-325.
Strain: CBA.
Tissue: Bone marrow.
[4]"The Cdk-like protein PCTAIRE-1 from mouse brain associates with p11 and 14-3-3 proteins."
Sladeczek F., Camonis J.H., Burnol A.-F., Le Bouffant F.
Mol. Gen. Genet. 254:571-577(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH YWHAH; YWHAQ AND YWHAZ.
[5]"Pctaire1 phosphorylates N-ethylmaleimide-sensitive fusion protein: implications in the regulation of its hexamerization and exocytosis."
Liu Y., Cheng K., Gong K., Fu A.K., Ip N.Y.
J. Biol. Chem. 281:9852-9858(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH NSF.
[6]"Cyclin-dependent kinase 5-dependent phosphorylation of Pctaire1 regulates dendrite development."
Fu W.Y., Cheng K., Fu A.K., Ip N.Y.
Neuroscience 180:353-359(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, MUTAGENESIS OF SER-95, PHOSPHORYLATION AT SER-95.
[7]"Analysis of substrate specificity and cyclin Y binding of PCTAIRE-1 kinase."
Shehata S.N., Hunter R.W., Ohta E., Peggie M.W., Lou H.J., Sicheri F., Zeqiraj E., Turk B.E., Sakamoto K.
Cell. Signal. 24:2085-2094(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: CATALYTIC ACTIVITY, INTERACTION WITH CCNY, TISSUE SPECIFICITY.
[8]"Brain-selective kinase 2 (BRSK2) phosphorylation on PCTAIRE1 negatively regulates glucose-stimulated insulin secretion in pancreatic beta-cells."
Chen X.Y., Gu X.T., Saiyin H., Wan B., Zhang Y.J., Li J., Wang Y.L., Gao R., Wang Y.F., Dong W.P., Najjar S.M., Zhang C.Y., Ding H.F., Liu J.O., Yu L.
J. Biol. Chem. 287:30368-30375(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY.
[9]"Cyclin-dependent kinase 16/PCTAIRE kinase 1 is activated by cyclin Y and is essential for spermatogenesis."
Mikolcevic P., Sigl R., Rauch V., Hess M.W., Pfaller K., Barisic M., Pelliniemi L.J., Boesl M., Geley S.
Mol. Cell. Biol. 32:868-879(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: DISRUPTION PHENOTYPE, FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH CCNY, TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X69025 mRNA. Translation: CAA48787.1.
BC011069 mRNA. Translation: AAH11069.1.
X64606 mRNA. Translation: CAA45890.1.
CCDSCCDS30045.1. [Q04735-1]
PIRS30435.
RefSeqNP_035179.1. NM_011049.4. [Q04735-1]
XP_006527633.1. XM_006527570.1. [Q04735-1]
UniGeneMm.102574.
Mm.392081.

3D structure databases

ProteinModelPortalQ04735.
SMRQ04735. Positions 71-472.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ04735.

Proteomic databases

MaxQBQ04735.
PaxDbQ04735.
PRIDEQ04735.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000033380; ENSMUSP00000033380; ENSMUSG00000031065. [Q04735-1]
ENSMUST00000115364; ENSMUSP00000111021; ENSMUSG00000031065. [Q04735-2]
GeneID18555.
KEGGmmu:18555.
UCSCuc009sto.1. mouse. [Q04735-1]

Organism-specific databases

CTD5127.
MGIMGI:97516. Cdk16.

Phylogenomic databases

eggNOGCOG0515.
HOGENOMHOG000233024.
HOVERGENHBG014652.
InParanoidQ04735.
KOK08820.
OMAVAMDRMK.
OrthoDBEOG7966H8.
PhylomeDBQ04735.
TreeFamTF106508.

Enzyme and pathway databases

BRENDA2.7.11.22. 3474.

Gene expression databases

BgeeQ04735.
CleanExMM_PCTK1.
GenevestigatorQ04735.

Family and domain databases

InterProIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMSSF56112. SSF56112. 1 hit.
PROSITEPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCDK16. mouse.
NextBio294376.
PROQ04735.
SOURCESearch...

Entry information

Entry nameCDK16_MOUSE
AccessionPrimary (citable) accession number: Q04735
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: July 9, 2014
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot