Q04735 (CDK16_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 125.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cyclin-dependent kinase 16 EC=2.7.11.22 Alternative name(s): CRK5 Cell division protein kinase 16 PCTAIRE-motif protein kinase 1 Serine/threonine-protein kinase PCTAIRE-1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 496 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Protein kinase that plays a role in vesicle-mediated transport processes and exocytosis. Can phosphorylate CCNY at 'Ser-336' (in vitro) By similarity. Plays a role in the regulation of insulin secretion in response to changes in blood glucose levels. Regulates GH1 release by brain neurons. Phosphorylates NSF, and thereby regulates NSF oligomerization. Required for normal spermatogenesis. Regulates neuron differentiation and dendrite development. Ref.5 Ref.7 Ref.9 Ref.10 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. Ref.5 Ref.8 Ref.10 |
| Subunit structure | Found in a complex containing CABLES1, CDK17 and TDRD7. Interacts with BRSK2. Identified in a complex with NSF, syntaxin-1, synaptotagmin, SYN1, SYP and CDK5R1 By similarity. Interacts with YWHAH, YWHAQ and YWHAZ. Interacts with CCNY; this increases the CDK16 kinase activity. Interacts with NSF. Ref.4 Ref.5 Ref.8 Ref.10 |
| Subcellular location | Cytoplasm By similarity. Cytoplasmic vesicle › secretory vesicle. Cell junction › synapse › synaptosome. Note: Colocalizes with insulin in pancreas islets By similarity. |
| Tissue specificity | Highly expressed in testis and brain, and detected at lower levels in heart, skeletal muscle, adipose tissue, lung, spleen and pancreas (at protein level). Ubiquitous with highest levels in testis and brain, with longer form predominant in all tissues except the testis. Ref.8 Ref.9 Ref.10 |
| Post-translational modification | Phosphorylation at Ser-153 inhibits kinase activity By similarity. |
| Disruption phenotype | No visible phenotype in females; they are viable and fertile. Male mice are infertile, due to a defect in late stages of spermatogenesis. Ref.10 |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: Q04735-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: Q04735-2) The sequence of this isoform differs from the canonical sequence as follows: 1-66: Missing. 67-67: P → MYTNGYDEEIYYIGGKRVFLTPKAWPFPLPTP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 496 | 496 | Cyclin-dependent kinase 16 | PRO_0000086485 | |||||
Regions | |||||||||
| Domain | 165 – 446 | 282 | Protein kinase | ||||||
| Nucleotide binding | 171 – 179 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 286 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 194 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 12 | 1 | Phosphoserine; by BRSK2 By similarity | ||||||
| Modified residue | 42 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 78 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 82 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 95 | 1 | Phosphoserine; by CDK5 Ref.7 | ||||||
| Modified residue | 110 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 119 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 138 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 153 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 155 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 66 | 66 | Missing in isoform Short. | VSP_004801 | |||||
| Alternative sequence | 67 | 1 | P → MYTNGYDEEIYYIGGKRVFL TPKAWPFPLPTP in isoform Short. | VSP_004802 | |||||
Experimental info | |||||||||
| Mutagenesis | 95 | 1 | S → A: Abolishes phosphorylation by CDK5. Impairs normal denrite development. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PCTAIRE-1 and PCTAIRE-3, two members of a novel cdc2/CDC28-related protein kinase gene family." Okuda T., Cleveland J.L., Downing J.R. Oncogene 7:2249-2258(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG). Tissue: Fibroblast. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG). |
| [3] | "Novel CDC2-related protein kinases produced in murine hematopoietic stem cells." Ershler M.A., Nagorskaya T.V., Visser J.W.M., Belyavsky A.V. Gene 124:305-306(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 290-325. Strain: CBA. Tissue: Bone marrow. |
| [4] | "The Cdk-like protein PCTAIRE-1 from mouse brain associates with p11 and 14-3-3 proteins." Sladeczek F., Camonis J.H., Burnol A.-F., Le Bouffant F. Mol. Gen. Genet. 254:571-577(1997) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH YWHAH; YWHAQ AND YWHAZ. |
| [5] | "Pctaire1 phosphorylates N-ethylmaleimide-sensitive fusion protein: implications in the regulation of its hexamerization and exocytosis." Liu Y., Cheng K., Gong K., Fu A.K., Ip N.Y. J. Biol. Chem. 281:9852-9858(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH NSF. |
| [6] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-110 AND SER-153, MASS SPECTROMETRY. Tissue: Melanoma. |
| [7] | "Cyclin-dependent kinase 5-dependent phosphorylation of Pctaire1 regulates dendrite development." Fu W.Y., Cheng K., Fu A.K., Ip N.Y. Neuroscience 180:353-359(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF SER-95, PHOSPHORYLATION AT SER-95. |
| [8] | "Analysis of substrate specificity and cyclin Y binding of PCTAIRE-1 kinase." Shehata S.N., Hunter R.W., Ohta E., Peggie M.W., Lou H.J., Sicheri F., Zeqiraj E., Turk B.E., Sakamoto K. Cell. Signal. 24:2085-2094(2012) [PubMed] [Europe PMC] [Abstract] Cited for: CATALYTIC ACTIVITY, INTERACTION WITH CCNY, TISSUE SPECIFICITY. |
| [9] | "Brain-selective kinase 2 (BRSK2) phosphorylation on PCTAIRE1 negatively regulates glucose-stimulated insulin secretion in pancreatic beta-cells." Chen X.Y., Gu X.T., Saiyin H., Wan B., Zhang Y.J., Li J., Wang Y.L., Gao R., Wang Y.F., Dong W.P., Najjar S.M., Zhang C.Y., Ding H.F., Liu J.O., Yu L. J. Biol. Chem. 287:30368-30375(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [10] | "Cyclin-dependent kinase 16/PCTAIRE kinase 1 is activated by cyclin Y and is essential for spermatogenesis." Mikolcevic P., Sigl R., Rauch V., Hess M.W., Pfaller K., Barisic M., Pelliniemi L.J., Boesl M., Geley S. Mol. Cell. Biol. 32:868-879(2012) [PubMed] [Europe PMC] [Abstract] Cited for: DISRUPTION PHENOTYPE, FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH CCNY, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X69025 mRNA. Translation: CAA48787.1. BC011069 mRNA. Translation: AAH11069.1. X64606 mRNA. Translation: CAA45890.1. |
| IPI | IPI00109670. IPI00228556. |
| PIR | S30435. |
| RefSeq | NP_035179.1. NM_011049.4. |
| UniGene | Mm.102574. |
3D structure databases | |
| ProteinModelPortal | Q04735. |
| SMR | Q04735. Positions 71-472. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q04735. |
Proteomic databases | |
| PaxDb | Q04735. |
| PRIDE | Q04735. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000033380; ENSMUSP00000033380; ENSMUSG00000031065. ENSMUST00000115364; ENSMUSP00000111021; ENSMUSG00000031065. |
| GeneID | 18555. |
| KEGG | mmu:18555. |
Organism-specific databases | |
| CTD | 5127. |
| MGI | MGI:97516. Cdk16. |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOGENOM | HOG000233024. |
| HOVERGEN | HBG014652. |
| InParanoid | Q04735. |
| KO | K08820. |
| OrthoDB | EOG44BB24. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.22. 3474. |
Gene expression databases | |
| ArrayExpress | Q04735. |
| Bgee | Q04735. |
| CleanEx | MM_PCTK1. |
| Genevestigator | Q04735. |
| GermOnline | ENSMUSG00000031065. Mus musculus. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CDK16. mouse. |
| NextBio | 294376. |
| SOURCE | Search... |
Entry information
| Entry name | CDK16_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q04735 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
