Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-dependent kinase 16

Gene

Cdk16

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Protein kinase that plays a role in vesicle-mediated transport processes and exocytosis. Can phosphorylate CCNY at 'Ser-336' (in vitro) (By similarity). Plays a role in the regulation of insulin secretion in response to changes in blood glucose levels. Regulates GH1 release by brain neurons. Phosphorylates NSF, and thereby regulates NSF oligomerization. Required for normal spermatogenesis. Regulates neuron differentiation and dendrite development.By similarity4 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei194ATPPROSITE-ProRule annotation1
Active sitei286Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi171 – 179ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB-EC
  • protein serine/threonine kinase activity Source: UniProtKB

GO - Biological processi

  • exocytosis Source: UniProtKB
  • growth hormone secretion Source: UniProtKB
  • neuron projection development Source: UniProtKB
  • regulation of insulin secretion involved in cellular response to glucose stimulus Source: UniProtKB
  • spermatogenesis Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Differentiation, Spermatogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.22. 3474.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 16 (EC:2.7.11.22)
Alternative name(s):
CRK5
Cell division protein kinase 16
PCTAIRE-motif protein kinase 1
Serine/threonine-protein kinase PCTAIRE-1
Gene namesi
Name:Cdk16
Synonyms:Crk5, Pctaire1, Pctk1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome X

Organism-specific databases

MGIiMGI:97516. Cdk16.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoplasmic vesicle, Synapse, Synaptosome

Pathology & Biotechi

Disruption phenotypei

No visible phenotype in females; they are viable and fertile. Male mice are infertile, due to a defect in late stages of spermatogenesis.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi95S → A: Abolishes phosphorylation by CDK5. Impairs normal denrite development. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000864851 – 496Cyclin-dependent kinase 16Add BLAST496

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei12Phosphoserine; by BRSK2By similarity1
Modified residuei42PhosphoserineBy similarity1
Modified residuei65PhosphoserineBy similarity1
Modified residuei78PhosphoserineCombined sources1
Modified residuei82PhosphoserineBy similarity1
Modified residuei95Phosphoserine; by CDK5Combined sources1 Publication1
Modified residuei110PhosphoserineBy similarity1
Modified residuei119PhosphoserineBy similarity1
Modified residuei138PhosphoserineBy similarity1
Modified residuei153PhosphoserineCombined sources1
Modified residuei155PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylation at Ser-153 inhibits kinase activity.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ04735.
PeptideAtlasiQ04735.
PRIDEiQ04735.

PTM databases

iPTMnetiQ04735.
PhosphoSitePlusiQ04735.

Expressioni

Tissue specificityi

Highly expressed in testis and brain, and detected at lower levels in heart, skeletal muscle, adipose tissue, lung, spleen and pancreas (at protein level). Ubiquitous with highest levels in testis and brain, with longer form predominant in all tissues except the testis.3 Publications

Gene expression databases

BgeeiENSMUSG00000031065.
CleanExiMM_PCTK1.
ExpressionAtlasiQ04735. baseline and differential.
GenevisibleiQ04735. MM.

Interactioni

Subunit structurei

Found in a complex containing CABLES1, CDK17 and TDRD7. Interacts with BRSK2. Identified in a complex with NSF, syntaxin-1, synaptotagmin, SYN1, SYP and CDK5R1 (By similarity). Interacts with YWHAH, YWHAQ and YWHAZ. Interacts with CCNY; this increases the CDK16 kinase activity. Interacts with NSF.By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CcnyQ8BGU53EBI-11615670,EBI-772904
Ccnyl1D3YUJ37EBI-11615670,EBI-11683033

Protein-protein interaction databases

IntActiQ04735. 2 interactors.
STRINGi10090.ENSMUSP00000033380.

Structurei

3D structure databases

ProteinModelPortaliQ04735.
SMRiQ04735.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini165 – 446Protein kinasePROSITE-ProRule annotationAdd BLAST282

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0594. Eukaryota.
ENOG410XPP3. LUCA.
GeneTreeiENSGT00790000122986.
HOGENOMiHOG000233024.
HOVERGENiHBG014652.
InParanoidiQ04735.
KOiK08820.
OMAiSNHTPRL.
OrthoDBiEOG091G0CH0.
PhylomeDBiQ04735.
TreeFamiTF106508.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: Q04735-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRMKKIKRQ LSMTLRGGRG IDKTNGVPEQ IGLDESGGGG GSDLGEAPTR
60 70 80 90 100
IAPGELRSVR GPLSSAPEIV HEDMKMGSDG ESDQASATSS DEVQSPVRVR
110 120 130 140 150
MRNHPPRKIS TEDINKRLSL PADIRLPEGY LEKLTLNSPI FDKPLSRRLR
160 170 180 190 200
RVSLSEIGFG KLETYIKLDK LGEGTYATVY KGKSKLTDNL VALKEIRLEH
210 220 230 240 250
EEGAPCTAIR EVSLLKDLKH ANIVTLHDII HTEKSLTLVF EYLDKDLKQY
260 270 280 290 300
LDDCGNVINM HNVKLFLFQL LRGLAYCHRQ KVLHRDLKPQ NLLINERGEL
310 320 330 340 350
KLADFGLARA KSIPTKTYSN EVVTLWYRPP DILLGSTDYS TQIDMWGVGC
360 370 380 390 400
IFYEMATGRP LFPGSTVEEQ LHFIFRILGT PTEETWPGIL SNEEFRTYNY
410 420 430 440 450
PKYRAEALLS HAPRLDSDGA DLLTKLLQFE GRNRISAEDA RKHPFFLSLG
460 470 480 490
ERIHKLPDTT SIFALKEVQL QKEANIRSTS MPDSGRPAFR VVDTEF
Length:496
Mass (Da):55,914
Last modified:October 1, 1993 - v1
Checksum:i0746036524B1FB5F
GO
Isoform Short (identifier: Q04735-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.
     67-67: P → MYTNGYDEEIYYIGGKRVFLTPKAWPFPLPTP

Show »
Length:461
Mass (Da):52,718
Checksum:i51AA256DB758DA34
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0048011 – 66Missing in isoform Short. CuratedAdd BLAST66
Alternative sequenceiVSP_00480267P → MYTNGYDEEIYYIGGKRVFL TPKAWPFPLPTP in isoform Short. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X69025 mRNA. Translation: CAA48787.1.
BC011069 mRNA. Translation: AAH11069.1.
X64606 mRNA. Translation: CAA45890.1.
CCDSiCCDS30045.1. [Q04735-1]
CCDS81103.1. [Q04735-2]
PIRiS30435.
RefSeqiNP_001297385.1. NM_001310456.1. [Q04735-2]
NP_035179.1. NM_011049.5. [Q04735-1]
XP_006527633.1. XM_006527570.1. [Q04735-1]
UniGeneiMm.102574.
Mm.392081.

Genome annotation databases

EnsembliENSMUST00000033380; ENSMUSP00000033380; ENSMUSG00000031065. [Q04735-1]
ENSMUST00000115364; ENSMUSP00000111021; ENSMUSG00000031065. [Q04735-2]
GeneIDi18555.
KEGGimmu:18555.
UCSCiuc009sto.1. mouse. [Q04735-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X69025 mRNA. Translation: CAA48787.1.
BC011069 mRNA. Translation: AAH11069.1.
X64606 mRNA. Translation: CAA45890.1.
CCDSiCCDS30045.1. [Q04735-1]
CCDS81103.1. [Q04735-2]
PIRiS30435.
RefSeqiNP_001297385.1. NM_001310456.1. [Q04735-2]
NP_035179.1. NM_011049.5. [Q04735-1]
XP_006527633.1. XM_006527570.1. [Q04735-1]
UniGeneiMm.102574.
Mm.392081.

3D structure databases

ProteinModelPortaliQ04735.
SMRiQ04735.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ04735. 2 interactors.
STRINGi10090.ENSMUSP00000033380.

PTM databases

iPTMnetiQ04735.
PhosphoSitePlusiQ04735.

Proteomic databases

PaxDbiQ04735.
PeptideAtlasiQ04735.
PRIDEiQ04735.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000033380; ENSMUSP00000033380; ENSMUSG00000031065. [Q04735-1]
ENSMUST00000115364; ENSMUSP00000111021; ENSMUSG00000031065. [Q04735-2]
GeneIDi18555.
KEGGimmu:18555.
UCSCiuc009sto.1. mouse. [Q04735-1]

Organism-specific databases

CTDi5127.
MGIiMGI:97516. Cdk16.

Phylogenomic databases

eggNOGiKOG0594. Eukaryota.
ENOG410XPP3. LUCA.
GeneTreeiENSGT00790000122986.
HOGENOMiHOG000233024.
HOVERGENiHBG014652.
InParanoidiQ04735.
KOiK08820.
OMAiSNHTPRL.
OrthoDBiEOG091G0CH0.
PhylomeDBiQ04735.
TreeFamiTF106508.

Enzyme and pathway databases

BRENDAi2.7.11.22. 3474.

Miscellaneous databases

ChiTaRSiCdk16. mouse.
PROiQ04735.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000031065.
CleanExiMM_PCTK1.
ExpressionAtlasiQ04735. baseline and differential.
GenevisibleiQ04735. MM.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCDK16_MOUSE
AccessioniPrimary (citable) accession number: Q04735
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: November 2, 2016
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.