Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q04727

- TLE4_HUMAN

UniProt

Q04727 - TLE4_HUMAN

Protein

Transducin-like enhancer protein 4

Gene

TLE4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 152 (01 Oct 2014)
      Sequence version 3 (11 Sep 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by PAX5, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Essential for the transcriptional repressor activity of SIX3 during retina and lens development and for SIX3 transcriptional auto-repression By similarity.By similarity

    GO - Molecular functioni

    1. chromatin binding Source: Ensembl
    2. RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity Source: Ensembl
    3. transcription corepressor activity Source: Ensembl

    GO - Biological processi

    1. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
    2. Notch signaling pathway Source: Reactome
    3. Wnt signaling pathway Source: UniProtKB-KW

    Keywords - Molecular functioni

    Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation, Wnt signaling pathway

    Enzyme and pathway databases

    ReactomeiREACT_118780. NOTCH1 Intracellular Domain Regulates Transcription.
    REACT_200731. deactivation of the beta-catenin transactivating complex.
    REACT_200753. formation of the beta-catenin:TCF transactivating complex.
    SignaLinkiQ04727.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transducin-like enhancer protein 4
    Alternative name(s):
    Grg-4
    Groucho-related protein 4
    Gene namesi
    Name:TLE4
    Synonyms:GRG4, KIAA1261
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:11840. TLE4.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleoplasm Source: Reactome
    2. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA36542.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 773773Transducin-like enhancer protein 4PRO_0000051283Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei237 – 2371N6-acetyllysine1 Publication
    Modified residuei250 – 2501Phosphoserine1 Publication
    Modified residuei269 – 2691Phosphoserine1 Publication
    Modified residuei281 – 2811N6-acetyllysine1 Publication
    Modified residuei292 – 2921Phosphoserine2 Publications

    Post-translational modificationi

    Phosphorylated. PAX5 binding increases phosphorylation By similarity.By similarity
    Ubiquitinated by XIAP/BIRC4.1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiQ04727.
    PaxDbiQ04727.
    PRIDEiQ04727.

    PTM databases

    PhosphoSiteiQ04727.

    Expressioni

    Tissue specificityi

    In all tissues examined, mostly in brain, and muscle.

    Gene expression databases

    ArrayExpressiQ04727.
    BgeeiQ04727.
    GenevestigatoriQ04727.

    Interactioni

    Subunit structurei

    Homooligomer and heterooligomer with other family members. Binds PAX5, LEF1, TCF7, TCF7L1 and TCF7L2. Interacts with ZNF703; TLE4 may mediate ZNF703 transcriptional repression. Interacts with SIX3 and SIX6 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi112946. 11 interactions.
    IntActiQ04727. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ04727.
    SMRiQ04727. Positions 441-773.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati485 – 52339WD 1Add
    BLAST
    Repeati531 – 57040WD 2Add
    BLAST
    Repeati575 – 61440WD 3Add
    BLAST
    Repeati617 – 65640WD 4Add
    BLAST
    Repeati658 – 69740WD 5Add
    BLAST
    Repeati699 – 73840WD 6Add
    BLAST
    Repeati740 – 77334WD 7Add
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni207 – 27468CCN domainAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1 – 137137Gln-rich (Q domain)Add
    BLAST
    Compositional biasi138 – 20568Gly/Pro-rich (GP domain)Add
    BLAST
    Compositional biasi405 – 41511Poly-AlaAdd
    BLAST

    Sequence similaritiesi

    Belongs to the WD repeat Groucho/TLE family.Curated
    Contains 7 WD repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, WD repeat

    Phylogenomic databases

    eggNOGiCOG2319.
    HOVERGENiHBG004689.
    OrthoDBiEOG7HQNC3.
    PhylomeDBiQ04727.
    TreeFamiTF314167.

    Family and domain databases

    Gene3Di2.130.10.10. 1 hit.
    InterProiIPR005617. Groucho/TLE_N.
    IPR009146. Groucho_enhance.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF03920. TLE_N. 1 hit.
    PF00400. WD40. 6 hits.
    [Graphical view]
    PRINTSiPR01850. GROUCHOFAMLY.
    SMARTiSM00320. WD40. 7 hits.
    [Graphical view]
    SUPFAMiSSF50978. SSF50978. 1 hit.
    PROSITEiPS00678. WD_REPEATS_1. 2 hits.
    PS50082. WD_REPEATS_2. 3 hits.
    PS50294. WD_REPEATS_REGION. 2 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q04727-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIRDLSKMYP QTRHPAPHQP AQPFKFTISE SCDRIKEEFQ FLQAQYHSLK    50
    LECEKLASEK TEMQRHYVMY YEMSYGLNIE MHKQAEIVKR LNAICAQVIP 100
    FLSQEHQQQV VQAVERAKQV TMAELNAIIG QQLQAQHLSH GHGLPVPLTP 150
    HPSGLQPPAI PPIGSSAGLL ALSSALGGQS HLPIKDEKKH HDNDHQRDRD 200
    SIKSSSVSPS ASFRGAEKHR NSADYSSESK KQKTEEKEIA ARYDSDGEKS 250
    DDNLVVDVSN EDPSSPRGSP AHSPRENGLD KTRLLKKDAP ISPASIASSS 300
    STPSSKSKEL SLNEKSTTPV SKSNTPTPRT DAPTPGSNST PGLRPVPGKP 350
    PGVDPLASSL RTPMAVPCPY PTPFGIVPHA GMNGELTSPG AAYAGLHNIS 400
    PQMSAAAAAA AAAAAYGRSP VVGFDPHHHM RVPAIPPNLT GIPGGKPAYS 450
    FHVSADGQMQ PVPFPPDALI GPGIPRHARQ INTLNHGEVV CAVTISNPTR 500
    HVYTGGKGCV KVWDISHPGN KSPVSQLDCL NRDNYIRSCR LLPDGRTLIV 550
    GGEASTLSIW DLAAPTPRIK AELTSSAPAC YALAISPDSK VCFSCCSDGN 600
    IAVWDLHNQT LVRQFQGHTD GASCIDISND GTKLWTGGLD NTVRSWDLRE 650
    GRQLQQHDFT SQIFSLGYCP TGEWLAVGME NSNVEVLHVT KPDKYQLHLH 700
    ESCVLSLKFA HCGKWFVSTG KDNLLNAWRT PYGASIFQSK ESSSVLSCDI 750
    SVDDKYIVTG SGDKKATVYE VIY 773
    Length:773
    Mass (Da):83,755
    Last modified:September 11, 2007 - v3
    Checksum:iDA138F1DA29E81B6
    GO
    Isoform 2 (identifier: Q04727-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         244-312: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:704
    Mass (Da):76,581
    Checksum:iEF8F211B53D9CD3C
    GO
    Isoform 3 (identifier: Q04727-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         312-312: L → LKRDMGKLSETRLSEDEQCTLGLQRWFCRLWFM

    Note: No experimental confirmation available.

    Show »
    Length:805
    Mass (Da):87,702
    Checksum:i7301C1C49E992219
    GO
    Isoform 4 (identifier: Q04727-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         106-130: Missing.

    Show »
    Length:748
    Mass (Da):81,011
    Checksum:i2402704F8D17A77E
    GO

    Sequence cautioni

    The sequence BAA86575.1 differs from that shown. Reason: Erroneous initiation.
    The sequence CAC22598.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAC22599.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAI13644.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAI13734.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAI41315.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti131 – 1311Q → QQ in CAB82397. (PubMed:17974005)Curated
    Sequence conflicti468 – 4681A → P in AAA61195. (PubMed:1303260)Curated
    Sequence conflicti509 – 5091C → A in AAA61195. (PubMed:1303260)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei106 – 13025Missing in isoform 4. 1 PublicationVSP_055169Add
    BLAST
    Alternative sequencei244 – 31269Missing in isoform 2. 1 PublicationVSP_030497Add
    BLAST
    Alternative sequencei312 – 3121L → LKRDMGKLSETRLSEDEQCT LGLQRWFCRLWFM in isoform 3. 1 PublicationVSP_030498

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB033087 mRNA. Translation: BAA86575.1. Different initiation.
    AK296342 mRNA. Translation: BAG59027.1.
    AL358975 Genomic DNA. Translation: CAC22598.1. Sequence problems.
    AL358975 Genomic DNA. Translation: CAC22599.1. Sequence problems.
    AL445252, AL353813, AL358975 Genomic DNA. Translation: CAI13644.1. Sequence problems.
    AL353813, AL445252, AL358975 Genomic DNA. Translation: CAI41315.1. Sequence problems.
    AL358975, AL445252, AL353813 Genomic DNA. Translation: CAI13734.1. Sequence problems.
    BC045650 mRNA. Translation: AAH45650.1.
    BC059405 mRNA. Translation: AAH59405.2.
    AL162059 mRNA. Translation: CAB82397.1.
    M99439 mRNA. Translation: AAA61195.1.
    CCDSiCCDS43837.1. [Q04727-1]
    CCDS65069.1. [Q04727-3]
    CCDS65070.1. [Q04727-4]
    PIRiT47149.
    RefSeqiNP_001269677.1. NM_001282748.1. [Q04727-3]
    NP_001269678.1. NM_001282749.1.
    NP_001269682.1. NM_001282753.1. [Q04727-2]
    NP_008936.2. NM_007005.4. [Q04727-1]
    UniGeneiHs.444213.

    Genome annotation databases

    EnsembliENST00000265284; ENSP00000265284; ENSG00000106829. [Q04727-4]
    ENST00000376537; ENSP00000365720; ENSG00000106829. [Q04727-3]
    ENST00000376552; ENSP00000365735; ENSG00000106829. [Q04727-1]
    GeneIDi7091.
    KEGGihsa:7091.
    UCSCiuc004alc.3. human. [Q04727-1]
    uc004ald.3. human. [Q04727-3]
    uc010mps.3. human. [Q04727-2]

    Polymorphism databases

    DMDMi158518541.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB033087 mRNA. Translation: BAA86575.1 . Different initiation.
    AK296342 mRNA. Translation: BAG59027.1 .
    AL358975 Genomic DNA. Translation: CAC22598.1 . Sequence problems.
    AL358975 Genomic DNA. Translation: CAC22599.1 . Sequence problems.
    AL445252 , AL353813 , AL358975 Genomic DNA. Translation: CAI13644.1 . Sequence problems.
    AL353813 , AL445252 , AL358975 Genomic DNA. Translation: CAI41315.1 . Sequence problems.
    AL358975 , AL445252 , AL353813 Genomic DNA. Translation: CAI13734.1 . Sequence problems.
    BC045650 mRNA. Translation: AAH45650.1 .
    BC059405 mRNA. Translation: AAH59405.2 .
    AL162059 mRNA. Translation: CAB82397.1 .
    M99439 mRNA. Translation: AAA61195.1 .
    CCDSi CCDS43837.1. [Q04727-1 ]
    CCDS65069.1. [Q04727-3 ]
    CCDS65070.1. [Q04727-4 ]
    PIRi T47149.
    RefSeqi NP_001269677.1. NM_001282748.1. [Q04727-3 ]
    NP_001269678.1. NM_001282749.1.
    NP_001269682.1. NM_001282753.1. [Q04727-2 ]
    NP_008936.2. NM_007005.4. [Q04727-1 ]
    UniGenei Hs.444213.

    3D structure databases

    ProteinModelPortali Q04727.
    SMRi Q04727. Positions 441-773.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112946. 11 interactions.
    IntActi Q04727. 3 interactions.

    PTM databases

    PhosphoSitei Q04727.

    Polymorphism databases

    DMDMi 158518541.

    Proteomic databases

    MaxQBi Q04727.
    PaxDbi Q04727.
    PRIDEi Q04727.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000265284 ; ENSP00000265284 ; ENSG00000106829 . [Q04727-4 ]
    ENST00000376537 ; ENSP00000365720 ; ENSG00000106829 . [Q04727-3 ]
    ENST00000376552 ; ENSP00000365735 ; ENSG00000106829 . [Q04727-1 ]
    GeneIDi 7091.
    KEGGi hsa:7091.
    UCSCi uc004alc.3. human. [Q04727-1 ]
    uc004ald.3. human. [Q04727-3 ]
    uc010mps.3. human. [Q04727-2 ]

    Organism-specific databases

    CTDi 7091.
    GeneCardsi GC09P082186.
    HGNCi HGNC:11840. TLE4.
    MIMi 605132. gene.
    neXtProti NX_Q04727.
    PharmGKBi PA36542.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2319.
    HOVERGENi HBG004689.
    OrthoDBi EOG7HQNC3.
    PhylomeDBi Q04727.
    TreeFami TF314167.

    Enzyme and pathway databases

    Reactomei REACT_118780. NOTCH1 Intracellular Domain Regulates Transcription.
    REACT_200731. deactivation of the beta-catenin transactivating complex.
    REACT_200753. formation of the beta-catenin:TCF transactivating complex.
    SignaLinki Q04727.

    Miscellaneous databases

    GenomeRNAii 7091.
    NextBioi 27739.
    PROi Q04727.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q04727.
    Bgeei Q04727.
    Genevestigatori Q04727.

    Family and domain databases

    Gene3Di 2.130.10.10. 1 hit.
    InterProi IPR005617. Groucho/TLE_N.
    IPR009146. Groucho_enhance.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF03920. TLE_N. 1 hit.
    PF00400. WD40. 6 hits.
    [Graphical view ]
    PRINTSi PR01850. GROUCHOFAMLY.
    SMARTi SM00320. WD40. 7 hits.
    [Graphical view ]
    SUPFAMi SSF50978. SSF50978. 1 hit.
    PROSITEi PS00678. WD_REPEATS_1. 2 hits.
    PS50082. WD_REPEATS_2. 3 hits.
    PS50294. WD_REPEATS_REGION. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
      DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Thalamus.
    3. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Testis.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 51-773 (ISOFORM 1).
      Tissue: Brain.
    6. "Human homologs of a Drosophila enhancer of split gene product define a novel family of nuclear proteins."
      Stifani S., Blaumueller C.M., Redhead N.J., Hill R.E., Artavanis-Tsakonas S.
      Nat. Genet. 2:119-127(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 326-773.
      Tissue: Fetal brain.
    7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250 AND SER-269, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-292, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    11. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
      Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
      Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-237 AND LYS-281, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-292, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. "XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling."
      Hanson A.J., Wallace H.A., Freeman T.J., Beauchamp R.D., Lee L.A., Lee E.
      Mol. Cell 45:619-628(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: UBIQUITINATION BY XIAP/BIRC4.

    Entry informationi

    Entry nameiTLE4_HUMAN
    AccessioniPrimary (citable) accession number: Q04727
    Secondary accession number(s): F8W6T6
    , Q3ZCS1, Q5T1Y2, Q6PCB3, Q9BZ07, Q9BZ08, Q9BZ09, Q9NSL3, Q9ULF9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1994
    Last sequence update: September 11, 2007
    Last modified: October 1, 2014
    This is version 152 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3