SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q04727

- TLE4_HUMAN

UniProt

Q04727 - TLE4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transducin-like enhancer protein 4

Gene
TLE4, KIAA1261
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by PAX5, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES By similarity.

GO - Molecular functioni

  1. chromatin binding Source: Ensembl
  2. RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity Source: Ensembl
  3. transcription corepressor activity Source: Ensembl

GO - Biological processi

  1. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
  2. Notch signaling pathway Source: Reactome
  3. regulation of transcription, DNA-templated Source: InterPro
  4. Wnt signaling pathway Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation, Wnt signaling pathway

Enzyme and pathway databases

ReactomeiREACT_118780. NOTCH1 Intracellular Domain Regulates Transcription.
REACT_200731. deactivation of the beta-catenin transactivating complex.
REACT_200753. formation of the beta-catenin:TCF transactivating complex.
SignaLinkiQ04727.

Names & Taxonomyi

Protein namesi
Recommended name:
Transducin-like enhancer protein 4
Gene namesi
Name:TLE4
Synonyms:KIAA1261
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:11840. TLE4.

Subcellular locationi

GO - Cellular componenti

  1. nucleoplasm Source: Reactome
  2. nucleus Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36542.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 773773Transducin-like enhancer protein 4PRO_0000051283Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei237 – 2371N6-acetyllysine1 Publication
Modified residuei250 – 2501Phosphoserine1 Publication
Modified residuei269 – 2691Phosphoserine1 Publication
Modified residuei281 – 2811N6-acetyllysine1 Publication
Modified residuei292 – 2921Phosphoserine2 Publications

Post-translational modificationi

Phosphorylated. PAX5 binding increases phosphorylation By similarity.
Ubiquitinated by XIAP/BIRC4.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ04727.
PaxDbiQ04727.
PRIDEiQ04727.

PTM databases

PhosphoSiteiQ04727.

Expressioni

Tissue specificityi

In all tissues examined, mostly in brain, and muscle.

Gene expression databases

ArrayExpressiQ04727.
BgeeiQ04727.
GenevestigatoriQ04727.

Interactioni

Subunit structurei

Homooligomer and heterooligomer with other family members. Binds PAX5, LEF1, TCF7, TCF7L1 and TCF7L2. Interacts with ZNF703; TLE4 may mediate ZNF703 transcriptional repression By similarity.

Protein-protein interaction databases

BioGridi112946. 11 interactions.
IntActiQ04727. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ04727.
SMRiQ04727. Positions 441-773.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati485 – 52339WD 1Add
BLAST
Repeati531 – 57040WD 2Add
BLAST
Repeati575 – 61440WD 3Add
BLAST
Repeati617 – 65640WD 4Add
BLAST
Repeati658 – 69740WD 5Add
BLAST
Repeati699 – 73840WD 6Add
BLAST
Repeati740 – 77334WD 7Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni207 – 27468CCN domainAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1 – 137137Gln-rich (Q domain)Add
BLAST
Compositional biasi138 – 20568Gly/Pro-rich (GP domain)Add
BLAST
Compositional biasi405 – 41511Poly-AlaAdd
BLAST

Sequence similaritiesi

Contains 7 WD repeats.

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
HOVERGENiHBG004689.
OrthoDBiEOG7HQNC3.
PhylomeDBiQ04727.
TreeFamiTF314167.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR005617. Groucho/TLE_N.
IPR009146. Groucho_enhance.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF03920. TLE_N. 1 hit.
PF00400. WD40. 6 hits.
[Graphical view]
PRINTSiPR01850. GROUCHOFAMLY.
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q04727-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MIRDLSKMYP QTRHPAPHQP AQPFKFTISE SCDRIKEEFQ FLQAQYHSLK    50
LECEKLASEK TEMQRHYVMY YEMSYGLNIE MHKQAEIVKR LNAICAQVIP 100
FLSQEHQQQV VQAVERAKQV TMAELNAIIG QQLQAQHLSH GHGLPVPLTP 150
HPSGLQPPAI PPIGSSAGLL ALSSALGGQS HLPIKDEKKH HDNDHQRDRD 200
SIKSSSVSPS ASFRGAEKHR NSADYSSESK KQKTEEKEIA ARYDSDGEKS 250
DDNLVVDVSN EDPSSPRGSP AHSPRENGLD KTRLLKKDAP ISPASIASSS 300
STPSSKSKEL SLNEKSTTPV SKSNTPTPRT DAPTPGSNST PGLRPVPGKP 350
PGVDPLASSL RTPMAVPCPY PTPFGIVPHA GMNGELTSPG AAYAGLHNIS 400
PQMSAAAAAA AAAAAYGRSP VVGFDPHHHM RVPAIPPNLT GIPGGKPAYS 450
FHVSADGQMQ PVPFPPDALI GPGIPRHARQ INTLNHGEVV CAVTISNPTR 500
HVYTGGKGCV KVWDISHPGN KSPVSQLDCL NRDNYIRSCR LLPDGRTLIV 550
GGEASTLSIW DLAAPTPRIK AELTSSAPAC YALAISPDSK VCFSCCSDGN 600
IAVWDLHNQT LVRQFQGHTD GASCIDISND GTKLWTGGLD NTVRSWDLRE 650
GRQLQQHDFT SQIFSLGYCP TGEWLAVGME NSNVEVLHVT KPDKYQLHLH 700
ESCVLSLKFA HCGKWFVSTG KDNLLNAWRT PYGASIFQSK ESSSVLSCDI 750
SVDDKYIVTG SGDKKATVYE VIY 773
Length:773
Mass (Da):83,755
Last modified:September 11, 2007 - v3
Checksum:iDA138F1DA29E81B6
GO
Isoform 2 (identifier: Q04727-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-312: Missing.

Note: No experimental confirmation available.

Show »
Length:704
Mass (Da):76,581
Checksum:iEF8F211B53D9CD3C
GO
Isoform 3 (identifier: Q04727-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     312-312: L → LKRDMGKLSETRLSEDEQCTLGLQRWFCRLWFM

Note: No experimental confirmation available.

Show »
Length:805
Mass (Da):87,702
Checksum:i7301C1C49E992219
GO
Isoform 4 (identifier: Q04727-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-130: Missing.

Show »
Length:748
Mass (Da):81,011
Checksum:i2402704F8D17A77E
GO

Sequence cautioni

The sequence BAA86575.1 differs from that shown. Reason: Erroneous initiation.
The sequence CAC22598.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAC22599.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAI13644.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAI13734.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAI41315.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei106 – 13025Missing in isoform 4. VSP_055169Add
BLAST
Alternative sequencei244 – 31269Missing in isoform 2. VSP_030497Add
BLAST
Alternative sequencei312 – 3121L → LKRDMGKLSETRLSEDEQCT LGLQRWFCRLWFM in isoform 3. VSP_030498

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti131 – 1311Q → QQ in CAB82397. 1 Publication
Sequence conflicti468 – 4681A → P in AAA61195. 1 Publication
Sequence conflicti509 – 5091C → A in AAA61195. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB033087 mRNA. Translation: BAA86575.1. Different initiation.
AK296342 mRNA. Translation: BAG59027.1.
AL358975 Genomic DNA. Translation: CAC22598.1. Sequence problems.
AL358975 Genomic DNA. Translation: CAC22599.1. Sequence problems.
AL445252, AL353813, AL358975 Genomic DNA. Translation: CAI13644.1. Sequence problems.
AL353813, AL445252, AL358975 Genomic DNA. Translation: CAI41315.1. Sequence problems.
AL358975, AL445252, AL353813 Genomic DNA. Translation: CAI13734.1. Sequence problems.
BC045650 mRNA. Translation: AAH45650.1.
BC059405 mRNA. Translation: AAH59405.2.
AL162059 mRNA. Translation: CAB82397.1.
M99439 mRNA. Translation: AAA61195.1.
CCDSiCCDS43837.1. [Q04727-1]
CCDS65069.1. [Q04727-3]
PIRiT47149.
RefSeqiNP_001269677.1. NM_001282748.1. [Q04727-3]
NP_001269678.1. NM_001282749.1.
NP_001269682.1. NM_001282753.1. [Q04727-2]
NP_008936.2. NM_007005.4. [Q04727-1]
UniGeneiHs.444213.

Genome annotation databases

EnsembliENST00000265284; ENSP00000265284; ENSG00000106829.
ENST00000376537; ENSP00000365720; ENSG00000106829. [Q04727-3]
ENST00000376552; ENSP00000365735; ENSG00000106829. [Q04727-1]
GeneIDi7091.
KEGGihsa:7091.
UCSCiuc004alc.3. human. [Q04727-1]
uc004ald.3. human. [Q04727-3]
uc010mps.3. human. [Q04727-2]

Polymorphism databases

DMDMi158518541.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB033087 mRNA. Translation: BAA86575.1 . Different initiation.
AK296342 mRNA. Translation: BAG59027.1 .
AL358975 Genomic DNA. Translation: CAC22598.1 . Sequence problems.
AL358975 Genomic DNA. Translation: CAC22599.1 . Sequence problems.
AL445252 , AL353813 , AL358975 Genomic DNA. Translation: CAI13644.1 . Sequence problems.
AL353813 , AL445252 , AL358975 Genomic DNA. Translation: CAI41315.1 . Sequence problems.
AL358975 , AL445252 , AL353813 Genomic DNA. Translation: CAI13734.1 . Sequence problems.
BC045650 mRNA. Translation: AAH45650.1 .
BC059405 mRNA. Translation: AAH59405.2 .
AL162059 mRNA. Translation: CAB82397.1 .
M99439 mRNA. Translation: AAA61195.1 .
CCDSi CCDS43837.1. [Q04727-1 ]
CCDS65069.1. [Q04727-3 ]
PIRi T47149.
RefSeqi NP_001269677.1. NM_001282748.1. [Q04727-3 ]
NP_001269678.1. NM_001282749.1.
NP_001269682.1. NM_001282753.1. [Q04727-2 ]
NP_008936.2. NM_007005.4. [Q04727-1 ]
UniGenei Hs.444213.

3D structure databases

ProteinModelPortali Q04727.
SMRi Q04727. Positions 441-773.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112946. 11 interactions.
IntActi Q04727. 3 interactions.

PTM databases

PhosphoSitei Q04727.

Polymorphism databases

DMDMi 158518541.

Proteomic databases

MaxQBi Q04727.
PaxDbi Q04727.
PRIDEi Q04727.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000265284 ; ENSP00000265284 ; ENSG00000106829 .
ENST00000376537 ; ENSP00000365720 ; ENSG00000106829 . [Q04727-3 ]
ENST00000376552 ; ENSP00000365735 ; ENSG00000106829 . [Q04727-1 ]
GeneIDi 7091.
KEGGi hsa:7091.
UCSCi uc004alc.3. human. [Q04727-1 ]
uc004ald.3. human. [Q04727-3 ]
uc010mps.3. human. [Q04727-2 ]

Organism-specific databases

CTDi 7091.
GeneCardsi GC09P082186.
HGNCi HGNC:11840. TLE4.
MIMi 605132. gene.
neXtProti NX_Q04727.
PharmGKBi PA36542.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2319.
HOVERGENi HBG004689.
OrthoDBi EOG7HQNC3.
PhylomeDBi Q04727.
TreeFami TF314167.

Enzyme and pathway databases

Reactomei REACT_118780. NOTCH1 Intracellular Domain Regulates Transcription.
REACT_200731. deactivation of the beta-catenin transactivating complex.
REACT_200753. formation of the beta-catenin:TCF transactivating complex.
SignaLinki Q04727.

Miscellaneous databases

GenomeRNAii 7091.
NextBioi 27739.
PROi Q04727.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q04727.
Bgeei Q04727.
Genevestigatori Q04727.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
InterProi IPR005617. Groucho/TLE_N.
IPR009146. Groucho_enhance.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF03920. TLE_N. 1 hit.
PF00400. WD40. 6 hits.
[Graphical view ]
PRINTSi PR01850. GROUCHOFAMLY.
SMARTi SM00320. WD40. 7 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 1 hit.
PROSITEi PS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Thalamus.
  3. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Testis.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 51-773 (ISOFORM 1).
    Tissue: Brain.
  6. "Human homologs of a Drosophila enhancer of split gene product define a novel family of nuclear proteins."
    Stifani S., Blaumueller C.M., Redhead N.J., Hill R.E., Artavanis-Tsakonas S.
    Nat. Genet. 2:119-127(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 326-773.
    Tissue: Fetal brain.
  7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250 AND SER-269, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-292, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-237 AND LYS-281, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-292, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling."
    Hanson A.J., Wallace H.A., Freeman T.J., Beauchamp R.D., Lee L.A., Lee E.
    Mol. Cell 45:619-628(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION BY XIAP/BIRC4.

Entry informationi

Entry nameiTLE4_HUMAN
AccessioniPrimary (citable) accession number: Q04727
Secondary accession number(s): F8W6T6
, Q3ZCS1, Q5T1Y2, Q6PCB3, Q9BZ07, Q9BZ08, Q9BZ09, Q9NSL3, Q9ULF9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: September 11, 2007
Last modified: September 3, 2014
This is version 151 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi