Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q04727 (TLE4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 148. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Transducin-like enhancer protein 4
Gene names
Name:TLE4
Synonyms:KIAA1261
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length773 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by PAX5, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES By similarity.

Subunit structure

Homooligomer and heterooligomer with other family members. Binds PAX5, LEF1, TCF7, TCF7L1 and TCF7L2. Interacts with ZNF703; TLE4 may mediate ZNF703 transcriptional repression By similarity.

Subcellular location

Nucleus.

Tissue specificity

In all tissues examined, mostly in brain, and muscle.

Post-translational modification

Phosphorylated. PAX5 binding increases phosphorylation By similarity.

Ubiquitinated by XIAP/BIRC4. Ref.12

Sequence similarities

Belongs to the WD repeat Groucho/TLE family.

Contains 7 WD repeats.

Sequence caution

The sequence BAA86575.1 differs from that shown. Reason: Erroneous initiation.

The sequence CAC22598.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAC22599.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAI13644.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAI13734.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAI41315.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q04727-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q04727-2)

The sequence of this isoform differs from the canonical sequence as follows:
     244-312: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q04727-3)

The sequence of this isoform differs from the canonical sequence as follows:
     312-312: L → LKRDMGKLSETRLSEDEQCTLGLQRWFCRLWFM
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 773773Transducin-like enhancer protein 4
PRO_0000051283

Regions

Repeat485 – 52339WD 1
Repeat531 – 57040WD 2
Repeat575 – 61440WD 3
Repeat617 – 65640WD 4
Repeat658 – 69740WD 5
Repeat699 – 73840WD 6
Repeat740 – 77334WD 7
Region207 – 27468CCN domain
Compositional bias1 – 137137Gln-rich (Q domain)
Compositional bias138 – 20568Gly/Pro-rich (GP domain)
Compositional bias405 – 41511Poly-Ala

Amino acid modifications

Modified residue2371N6-acetyllysine Ref.10
Modified residue2501Phosphoserine Ref.6
Modified residue2691Phosphoserine Ref.6
Modified residue2811N6-acetyllysine Ref.10
Modified residue2921Phosphoserine Ref.9 Ref.11

Natural variations

Alternative sequence244 – 31269Missing in isoform 2.
VSP_030497
Alternative sequence3121L → LKRDMGKLSETRLSEDEQCT LGLQRWFCRLWFM in isoform 3.
VSP_030498

Experimental info

Sequence conflict1311Q → QQ in CAB82397. Ref.4
Sequence conflict4681A → P in AAA61195. Ref.5
Sequence conflict5091C → A in AAA61195. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified September 11, 2007. Version 3.
Checksum: DA138F1DA29E81B6

FASTA77383,755
        10         20         30         40         50         60 
MIRDLSKMYP QTRHPAPHQP AQPFKFTISE SCDRIKEEFQ FLQAQYHSLK LECEKLASEK 

        70         80         90        100        110        120 
TEMQRHYVMY YEMSYGLNIE MHKQAEIVKR LNAICAQVIP FLSQEHQQQV VQAVERAKQV 

       130        140        150        160        170        180 
TMAELNAIIG QQLQAQHLSH GHGLPVPLTP HPSGLQPPAI PPIGSSAGLL ALSSALGGQS 

       190        200        210        220        230        240 
HLPIKDEKKH HDNDHQRDRD SIKSSSVSPS ASFRGAEKHR NSADYSSESK KQKTEEKEIA 

       250        260        270        280        290        300 
ARYDSDGEKS DDNLVVDVSN EDPSSPRGSP AHSPRENGLD KTRLLKKDAP ISPASIASSS 

       310        320        330        340        350        360 
STPSSKSKEL SLNEKSTTPV SKSNTPTPRT DAPTPGSNST PGLRPVPGKP PGVDPLASSL 

       370        380        390        400        410        420 
RTPMAVPCPY PTPFGIVPHA GMNGELTSPG AAYAGLHNIS PQMSAAAAAA AAAAAYGRSP 

       430        440        450        460        470        480 
VVGFDPHHHM RVPAIPPNLT GIPGGKPAYS FHVSADGQMQ PVPFPPDALI GPGIPRHARQ 

       490        500        510        520        530        540 
INTLNHGEVV CAVTISNPTR HVYTGGKGCV KVWDISHPGN KSPVSQLDCL NRDNYIRSCR 

       550        560        570        580        590        600 
LLPDGRTLIV GGEASTLSIW DLAAPTPRIK AELTSSAPAC YALAISPDSK VCFSCCSDGN 

       610        620        630        640        650        660 
IAVWDLHNQT LVRQFQGHTD GASCIDISND GTKLWTGGLD NTVRSWDLRE GRQLQQHDFT 

       670        680        690        700        710        720 
SQIFSLGYCP TGEWLAVGME NSNVEVLHVT KPDKYQLHLH ESCVLSLKFA HCGKWFVSTG 

       730        740        750        760        770 
KDNLLNAWRT PYGASIFQSK ESSSVLSCDI SVDDKYIVTG SGDKKATVYE VIY 

« Hide

Isoform 2 [UniParc].

Checksum: EF8F211B53D9CD3C
Show »

FASTA70476,581
Isoform 3 [UniParc].

Checksum: 7301C1C49E992219
Show »

FASTA80587,702

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Tissue: Testis.
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 51-773 (ISOFORM 1).
Tissue: Brain.
[5]"Human homologs of a Drosophila enhancer of split gene product define a novel family of nuclear proteins."
Stifani S., Blaumueller C.M., Redhead N.J., Hill R.E., Artavanis-Tsakonas S.
Nat. Genet. 2:119-127(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 326-773.
Tissue: Fetal brain.
[6]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250 AND SER-269, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[9]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-292, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[10]"Lysine acetylation targets protein complexes and co-regulates major cellular functions."
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-237 AND LYS-281, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-292, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[12]"XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling."
Hanson A.J., Wallace H.A., Freeman T.J., Beauchamp R.D., Lee L.A., Lee E.
Mol. Cell 45:619-628(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: UBIQUITINATION BY XIAP/BIRC4.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB033087 mRNA. Translation: BAA86575.1. Different initiation.
AL358975 Genomic DNA. Translation: CAC22598.1. Sequence problems.
AL358975 Genomic DNA. Translation: CAC22599.1. Sequence problems.
AL445252, AL353813, AL358975 Genomic DNA. Translation: CAI13644.1. Sequence problems.
AL353813, AL445252, AL358975 Genomic DNA. Translation: CAI41315.1. Sequence problems.
AL358975, AL445252, AL353813 Genomic DNA. Translation: CAI13734.1. Sequence problems.
BC045650 mRNA. Translation: AAH45650.1.
BC059405 mRNA. Translation: AAH59405.2.
AL162059 mRNA. Translation: CAB82397.1.
M99439 mRNA. Translation: AAA61195.1.
PIRT47149.
RefSeqNP_001269677.1. NM_001282748.1.
NP_001269682.1. NM_001282753.1.
NP_008936.2. NM_007005.4.
UniGeneHs.444213.

3D structure databases

ProteinModelPortalQ04727.
SMRQ04727. Positions 441-773.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid112946. 11 interactions.
IntActQ04727. 3 interactions.

PTM databases

PhosphoSiteQ04727.

Polymorphism databases

DMDM158518541.

Proteomic databases

PaxDbQ04727.
PRIDEQ04727.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000376537; ENSP00000365720; ENSG00000106829. [Q04727-3]
ENST00000376552; ENSP00000365735; ENSG00000106829. [Q04727-1]
GeneID7091.
KEGGhsa:7091.
UCSCuc004alc.3. human. [Q04727-1]
uc004ald.3. human. [Q04727-3]
uc010mps.3. human. [Q04727-2]

Organism-specific databases

CTD7091.
GeneCardsGC09P082186.
HGNCHGNC:11840. TLE4.
MIM605132. gene.
neXtProtNX_Q04727.
PharmGKBPA36542.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2319.
HOVERGENHBG004689.
OrthoDBEOG7HQNC3.
PhylomeDBQ04727.
TreeFamTF314167.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.
REACT_116125. Disease.
SignaLinkQ04727.

Gene expression databases

ArrayExpressQ04727.
BgeeQ04727.
GenevestigatorQ04727.

Family and domain databases

Gene3D2.130.10.10. 1 hit.
InterProIPR005617. Groucho/TLE_N.
IPR009146. Groucho_enhance.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamPF03920. TLE_N. 1 hit.
PF00400. WD40. 6 hits.
[Graphical view]
PRINTSPR01850. GROUCHOFAMLY.
SMARTSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMSSF50978. SSF50978. 1 hit.
PROSITEPS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi7091.
NextBio27739.
PROQ04727.
SOURCESearch...

Entry information

Entry nameTLE4_HUMAN
AccessionPrimary (citable) accession number: Q04727
Secondary accession number(s): Q3ZCS1 expand/collapse secondary AC list , Q5T1Y2, Q6PCB3, Q9BZ07, Q9BZ08, Q9BZ09, Q9NSL3, Q9ULF9
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: September 11, 2007
Last modified: April 16, 2014
This is version 148 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM