Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transducin-like enhancer protein 4

Gene

TLE4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by PAX5, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Essential for the transcriptional repressor activity of SIX3 during retina and lens development and for SIX3 transcriptional auto-repression (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation, Wnt signaling pathway

Enzyme and pathway databases

ReactomeiREACT_118780. NOTCH1 Intracellular Domain Regulates Transcription.
REACT_264178. deactivation of the beta-catenin transactivating complex.
REACT_264242. formation of the beta-catenin:TCF transactivating complex.
REACT_264567. repression of WNT target genes.
SignaLinkiQ04727.

Names & Taxonomyi

Protein namesi
Recommended name:
Transducin-like enhancer protein 4
Alternative name(s):
Grg-4
Groucho-related protein 4
Gene namesi
Name:TLE4
Synonyms:GRG4, KIAA1261
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:11840. TLE4.

Subcellular locationi

GO - Cellular componenti

  • nucleoplasm Source: Reactome
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36542.

Polymorphism and mutation databases

DMDMi158518541.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 773773Transducin-like enhancer protein 4PRO_0000051283Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei208 – 2081Phosphoserine1 Publication
Modified residuei212 – 2121PhosphoserineBy similarity
Modified residuei222 – 2221PhosphoserineBy similarity
Modified residuei237 – 2371N6-acetyllysine1 Publication
Modified residuei245 – 2451PhosphoserineBy similarity
Modified residuei250 – 2501Phosphoserine1 Publication
Modified residuei269 – 2691Phosphoserine1 Publication
Modified residuei273 – 2731PhosphoserineBy similarity
Modified residuei281 – 2811N6-acetyllysine1 Publication
Modified residuei292 – 2921Phosphoserine2 Publications
Modified residuei318 – 3181PhosphothreonineBy similarity
Modified residuei323 – 3231PhosphoserineBy similarity
Modified residuei325 – 3251PhosphothreonineBy similarity
Modified residuei327 – 3271PhosphothreonineBy similarity
Modified residuei334 – 3341PhosphothreonineBy similarity
Modified residuei340 – 3401PhosphothreonineBy similarity
Modified residuei419 – 4191PhosphoserineBy similarity

Post-translational modificationi

Phosphorylated. PAX5 binding increases phosphorylation (By similarity).By similarity
Ubiquitinated by XIAP/BIRC4.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ04727.
PaxDbiQ04727.
PRIDEiQ04727.

PTM databases

PhosphoSiteiQ04727.

Expressioni

Tissue specificityi

In all tissues examined, mostly in brain, and muscle.

Gene expression databases

BgeeiQ04727.
ExpressionAtlasiQ04727. baseline and differential.
GenevisibleiQ04727. HS.

Interactioni

Subunit structurei

Homooligomer and heterooligomer with other family members. Binds PAX5, LEF1, TCF7, TCF7L1 and TCF7L2. Interacts with ZNF703; TLE4 may mediate ZNF703 transcriptional repression. Interacts with SIX3 and SIX6 (By similarity). Interacts with PAX2.By similarity1 Publication

Protein-protein interaction databases

BioGridi112946. 15 interactions.
IntActiQ04727. 3 interactions.
STRINGi9606.ENSP00000365735.

Structurei

3D structure databases

ProteinModelPortaliQ04727.
SMRiQ04727. Positions 27-132, 441-773.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati485 – 52339WD 1Add
BLAST
Repeati531 – 57040WD 2Add
BLAST
Repeati575 – 61440WD 3Add
BLAST
Repeati617 – 65640WD 4Add
BLAST
Repeati658 – 69740WD 5Add
BLAST
Repeati699 – 73840WD 6Add
BLAST
Repeati740 – 77334WD 7Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 136136Q domain1 PublicationAdd
BLAST
Regioni137 – 20468GP domain1 PublicationAdd
BLAST
Regioni205 – 27470CcN domain1 PublicationAdd
BLAST
Regioni275 – 452178SP domain1 PublicationAdd
BLAST

Domaini

WD repeat Groucho/TLE family members are characterized by 5 regions, a glutamine-rich Q domain, a glycine/proline-rich GP domain, a central CcN domain, containing a nuclear localization signal, and a serine/proline-rich SP domain. The most highly conserved are the N-terminal Q domain and the C-terminal WD-repeat domain.1 Publication

Sequence similaritiesi

Belongs to the WD repeat Groucho/TLE family.Curated
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
GeneTreeiENSGT00550000074465.
HOVERGENiHBG004689.
InParanoidiQ04727.
OMAiCPYPAPF.
OrthoDBiEOG7HQNC3.
PhylomeDBiQ04727.
TreeFamiTF314167.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR005617. Groucho/TLE_N.
IPR009146. Groucho_enhance.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF03920. TLE_N. 1 hit.
PF00400. WD40. 6 hits.
[Graphical view]
PRINTSiPR01850. GROUCHOFAMLY.
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q04727-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIRDLSKMYP QTRHPAPHQP AQPFKFTISE SCDRIKEEFQ FLQAQYHSLK
60 70 80 90 100
LECEKLASEK TEMQRHYVMY YEMSYGLNIE MHKQAEIVKR LNAICAQVIP
110 120 130 140 150
FLSQEHQQQV VQAVERAKQV TMAELNAIIG QQLQAQHLSH GHGLPVPLTP
160 170 180 190 200
HPSGLQPPAI PPIGSSAGLL ALSSALGGQS HLPIKDEKKH HDNDHQRDRD
210 220 230 240 250
SIKSSSVSPS ASFRGAEKHR NSADYSSESK KQKTEEKEIA ARYDSDGEKS
260 270 280 290 300
DDNLVVDVSN EDPSSPRGSP AHSPRENGLD KTRLLKKDAP ISPASIASSS
310 320 330 340 350
STPSSKSKEL SLNEKSTTPV SKSNTPTPRT DAPTPGSNST PGLRPVPGKP
360 370 380 390 400
PGVDPLASSL RTPMAVPCPY PTPFGIVPHA GMNGELTSPG AAYAGLHNIS
410 420 430 440 450
PQMSAAAAAA AAAAAYGRSP VVGFDPHHHM RVPAIPPNLT GIPGGKPAYS
460 470 480 490 500
FHVSADGQMQ PVPFPPDALI GPGIPRHARQ INTLNHGEVV CAVTISNPTR
510 520 530 540 550
HVYTGGKGCV KVWDISHPGN KSPVSQLDCL NRDNYIRSCR LLPDGRTLIV
560 570 580 590 600
GGEASTLSIW DLAAPTPRIK AELTSSAPAC YALAISPDSK VCFSCCSDGN
610 620 630 640 650
IAVWDLHNQT LVRQFQGHTD GASCIDISND GTKLWTGGLD NTVRSWDLRE
660 670 680 690 700
GRQLQQHDFT SQIFSLGYCP TGEWLAVGME NSNVEVLHVT KPDKYQLHLH
710 720 730 740 750
ESCVLSLKFA HCGKWFVSTG KDNLLNAWRT PYGASIFQSK ESSSVLSCDI
760 770
SVDDKYIVTG SGDKKATVYE VIY
Length:773
Mass (Da):83,755
Last modified:September 11, 2007 - v3
Checksum:iDA138F1DA29E81B6
GO
Isoform 2 (identifier: Q04727-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-312: Missing.

Note: No experimental confirmation available.
Show »
Length:704
Mass (Da):76,581
Checksum:iEF8F211B53D9CD3C
GO
Isoform 3 (identifier: Q04727-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     312-312: L → LKRDMGKLSETRLSEDEQCTLGLQRWFCRLWFM

Note: No experimental confirmation available.
Show »
Length:805
Mass (Da):87,702
Checksum:i7301C1C49E992219
GO
Isoform 4 (identifier: Q04727-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-130: Missing.

Show »
Length:748
Mass (Da):81,011
Checksum:i2402704F8D17A77E
GO

Sequence cautioni

The sequence BAA86575.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAC22598.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAC22599.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI13644.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI13734.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI41315.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti131 – 1311Q → QQ in CAB82397 (PubMed:17974005).Curated
Sequence conflicti468 – 4681A → P in AAA61195 (PubMed:1303260).Curated
Sequence conflicti509 – 5091C → A in AAA61195 (PubMed:1303260).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei106 – 13025Missing in isoform 4. 1 PublicationVSP_055169Add
BLAST
Alternative sequencei244 – 31269Missing in isoform 2. 1 PublicationVSP_030497Add
BLAST
Alternative sequencei312 – 3121L → LKRDMGKLSETRLSEDEQCT LGLQRWFCRLWFM in isoform 3. 1 PublicationVSP_030498

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB033087 mRNA. Translation: BAA86575.1. Different initiation.
AK296342 mRNA. Translation: BAG59027.1.
AL358975 Genomic DNA. Translation: CAC22598.1. Sequence problems.
AL358975 Genomic DNA. Translation: CAC22599.1. Sequence problems.
AL445252, AL353813, AL358975 Genomic DNA. Translation: CAI13644.1. Sequence problems.
AL353813, AL445252, AL358975 Genomic DNA. Translation: CAI41315.1. Sequence problems.
AL358975, AL445252, AL353813 Genomic DNA. Translation: CAI13734.1. Sequence problems.
BC045650 mRNA. Translation: AAH45650.1.
BC059405 mRNA. Translation: AAH59405.2.
AL162059 mRNA. Translation: CAB82397.1.
M99439 mRNA. Translation: AAA61195.1.
CCDSiCCDS43837.1. [Q04727-1]
CCDS65069.1. [Q04727-3]
CCDS65070.1. [Q04727-4]
CCDS75851.1. [Q04727-2]
PIRiT47149.
RefSeqiNP_001269677.1. NM_001282748.1. [Q04727-3]
NP_001269678.1. NM_001282749.1. [Q04727-4]
NP_001269682.1. NM_001282753.1. [Q04727-2]
NP_008936.2. NM_007005.4. [Q04727-1]
UniGeneiHs.444213.

Genome annotation databases

EnsembliENST00000265284; ENSP00000265284; ENSG00000106829. [Q04727-4]
ENST00000376537; ENSP00000365720; ENSG00000106829. [Q04727-3]
ENST00000376544; ENSP00000365727; ENSG00000106829. [Q04727-2]
ENST00000376552; ENSP00000365735; ENSG00000106829.
GeneIDi7091.
KEGGihsa:7091.
UCSCiuc004alc.3. human. [Q04727-1]
uc004ald.3. human. [Q04727-3]
uc010mps.3. human. [Q04727-2]
uc011lsq.2. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB033087 mRNA. Translation: BAA86575.1. Different initiation.
AK296342 mRNA. Translation: BAG59027.1.
AL358975 Genomic DNA. Translation: CAC22598.1. Sequence problems.
AL358975 Genomic DNA. Translation: CAC22599.1. Sequence problems.
AL445252, AL353813, AL358975 Genomic DNA. Translation: CAI13644.1. Sequence problems.
AL353813, AL445252, AL358975 Genomic DNA. Translation: CAI41315.1. Sequence problems.
AL358975, AL445252, AL353813 Genomic DNA. Translation: CAI13734.1. Sequence problems.
BC045650 mRNA. Translation: AAH45650.1.
BC059405 mRNA. Translation: AAH59405.2.
AL162059 mRNA. Translation: CAB82397.1.
M99439 mRNA. Translation: AAA61195.1.
CCDSiCCDS43837.1. [Q04727-1]
CCDS65069.1. [Q04727-3]
CCDS65070.1. [Q04727-4]
CCDS75851.1. [Q04727-2]
PIRiT47149.
RefSeqiNP_001269677.1. NM_001282748.1. [Q04727-3]
NP_001269678.1. NM_001282749.1. [Q04727-4]
NP_001269682.1. NM_001282753.1. [Q04727-2]
NP_008936.2. NM_007005.4. [Q04727-1]
UniGeneiHs.444213.

3D structure databases

ProteinModelPortaliQ04727.
SMRiQ04727. Positions 27-132, 441-773.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112946. 15 interactions.
IntActiQ04727. 3 interactions.
STRINGi9606.ENSP00000365735.

PTM databases

PhosphoSiteiQ04727.

Polymorphism and mutation databases

DMDMi158518541.

Proteomic databases

MaxQBiQ04727.
PaxDbiQ04727.
PRIDEiQ04727.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265284; ENSP00000265284; ENSG00000106829. [Q04727-4]
ENST00000376537; ENSP00000365720; ENSG00000106829. [Q04727-3]
ENST00000376544; ENSP00000365727; ENSG00000106829. [Q04727-2]
ENST00000376552; ENSP00000365735; ENSG00000106829.
GeneIDi7091.
KEGGihsa:7091.
UCSCiuc004alc.3. human. [Q04727-1]
uc004ald.3. human. [Q04727-3]
uc010mps.3. human. [Q04727-2]
uc011lsq.2. human.

Organism-specific databases

CTDi7091.
GeneCardsiGC09P082186.
HGNCiHGNC:11840. TLE4.
MIMi605132. gene.
neXtProtiNX_Q04727.
PharmGKBiPA36542.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG2319.
GeneTreeiENSGT00550000074465.
HOVERGENiHBG004689.
InParanoidiQ04727.
OMAiCPYPAPF.
OrthoDBiEOG7HQNC3.
PhylomeDBiQ04727.
TreeFamiTF314167.

Enzyme and pathway databases

ReactomeiREACT_118780. NOTCH1 Intracellular Domain Regulates Transcription.
REACT_264178. deactivation of the beta-catenin transactivating complex.
REACT_264242. formation of the beta-catenin:TCF transactivating complex.
REACT_264567. repression of WNT target genes.
SignaLinkiQ04727.

Miscellaneous databases

ChiTaRSiTLE4. human.
GenomeRNAii7091.
NextBioi27739.
PROiQ04727.
SOURCEiSearch...

Gene expression databases

BgeeiQ04727.
ExpressionAtlasiQ04727. baseline and differential.
GenevisibleiQ04727. HS.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR005617. Groucho/TLE_N.
IPR009146. Groucho_enhance.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF03920. TLE_N. 1 hit.
PF00400. WD40. 6 hits.
[Graphical view]
PRINTSiPR01850. GROUCHOFAMLY.
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Thalamus.
  3. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Testis.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 51-773 (ISOFORM 1).
    Tissue: Brain.
  6. "Human homologs of a Drosophila enhancer of split gene product define a novel family of nuclear proteins."
    Stifani S., Blaumueller C.M., Redhead N.J., Hill R.E., Artavanis-Tsakonas S.
    Nat. Genet. 2:119-127(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 326-773.
    Tissue: Fetal brain.
  7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250 AND SER-269, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "The Groucho/TLE/Grg family of transcriptional co-repressors."
    Jennings B.H., Ish-Horowicz D.
    Genome Biol. 9:R205.1-R205.7(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-292, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  12. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-237 AND LYS-281, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "EphrinB1 interacts with the transcriptional co-repressor Groucho/xTLE4."
    Kamata T., Bong Y.S., Mood K., Park M.J., Nishanian T.G., Lee H.S.
    BMB Rep. 44:199-204(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: Q; GP; CCN AND SP DOMAIN BOUNDARIES.
  14. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-292, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling."
    Hanson A.J., Wallace H.A., Freeman T.J., Beauchamp R.D., Lee L.A., Lee E.
    Mol. Cell 45:619-628(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION BY XIAP/BIRC4.
  16. Cited for: INTERACTION WITH PAX2.
  17. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-208, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiTLE4_HUMAN
AccessioniPrimary (citable) accession number: Q04727
Secondary accession number(s): F8W6T6
, Q3ZCS1, Q5T1Y2, Q6PCB3, Q9BZ07, Q9BZ08, Q9BZ09, Q9NSL3, Q9ULF9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: September 11, 2007
Last modified: July 22, 2015
This is version 162 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-8 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.