Q04727 (TLE4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 138.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transducin-like enhancer protein 4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 773 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by PAX5, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES By similarity. |
| Subunit structure | Homooligomer and heterooligomer with other family members. Binds PAX5, LEF1, TCF7, TCF7L1 and TCF7L2. Interacts with ZNF703; TLE4 may mediate ZNF703 transcriptional repression By similarity. |
| Subcellular location | |
| Tissue specificity | In all tissues examined, mostly in brain, and muscle. |
| Post-translational modification | Phosphorylated. PAX5 binding increases phosphorylation By similarity. Ubiquitinated by XIAP/BIRC4. Ref.11 |
| Sequence similarities | Belongs to the WD repeat Groucho/TLE family. Contains 7 WD repeats. |
| Sequence caution | The sequence BAA86575.1 differs from that shown. Reason: Erroneous initiation. The sequence CAC22598.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAC22599.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI13644.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI13734.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI41315.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q04727-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q04727-2) The sequence of this isoform differs from the canonical sequence as follows: 244-312: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q04727-3) The sequence of this isoform differs from the canonical sequence as follows: 312-312: L → LKRDMGKLSETRLSEDEQCTLGLQRWFCRLWFM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 773 | 773 | Transducin-like enhancer protein 4 | PRO_0000051283 | |||||
Regions | |||||||||
| Repeat | 485 – 523 | 39 | WD 1 | ||||||
| Repeat | 531 – 570 | 40 | WD 2 | ||||||
| Repeat | 575 – 614 | 40 | WD 3 | ||||||
| Repeat | 617 – 656 | 40 | WD 4 | ||||||
| Repeat | 658 – 697 | 40 | WD 5 | ||||||
| Repeat | 699 – 738 | 40 | WD 6 | ||||||
| Repeat | 740 – 773 | 34 | WD 7 | ||||||
| Region | 207 – 274 | 68 | CCN domain | ||||||
| Compositional bias | 1 – 137 | 137 | Gln-rich (Q domain) | ||||||
| Compositional bias | 138 – 205 | 68 | Gly/Pro-rich (GP domain) | ||||||
| Compositional bias | 405 – 415 | 11 | Poly-Ala | ||||||
Amino acid modifications | |||||||||
| Modified residue | 237 | 1 | N6-acetyllysine Ref.9 | ||||||
| Modified residue | 250 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 269 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 281 | 1 | N6-acetyllysine Ref.9 | ||||||
| Modified residue | 292 | 1 | Phosphoserine Ref.8 Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 244 – 312 | 69 | Missing in isoform 2. | VSP_030497 | |||||
| Alternative sequence | 312 | 1 | L → LKRDMGKLSETRLSEDEQCT LGLQRWFCRLWFM in isoform 3. | VSP_030498 | |||||
Experimental info | |||||||||
| Sequence conflict | 131 | 1 | Q → QQ in CAB82397. Ref.4 | ||||||
| Sequence conflict | 468 | 1 | A → P in AAA61195. Ref.5 | ||||||
| Sequence conflict | 509 | 1 | C → A in AAA61195. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O. DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Testis. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 51-773 (ISOFORM 1). Tissue: Brain. |
| [5] | "Human homologs of a Drosophila enhancer of split gene product define a novel family of nuclear proteins." Stifani S., Blaumueller C.M., Redhead N.J., Hill R.E., Artavanis-Tsakonas S. Nat. Genet. 2:119-127(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 326-773. Tissue: Fetal brain. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250 AND SER-269, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [8] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-292, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [9] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-237 AND LYS-281, MASS SPECTROMETRY. |
| [10] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-292, MASS SPECTROMETRY. |
| [11] | "XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling." Hanson A.J., Wallace H.A., Freeman T.J., Beauchamp R.D., Lee L.A., Lee E. Mol. Cell 45:619-628(2012) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION BY XIAP/BIRC4. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB033087 mRNA. Translation: BAA86575.1. Different initiation. AL358975 Genomic DNA. Translation: CAC22598.1. Sequence problems. AL358975 Genomic DNA. Translation: CAC22599.1. Sequence problems. AL445252, AL353813, AL358975 Genomic DNA. Translation: CAI13644.1. Sequence problems. AL353813, AL445252, AL358975 Genomic DNA. Translation: CAI41315.1. Sequence problems. AL358975, AL445252, AL353813 Genomic DNA. Translation: CAI13734.1. Sequence problems. BC045650 mRNA. Translation: AAH45650.1. BC059405 mRNA. Translation: AAH59405.2. AL162059 mRNA. Translation: CAB82397.1. M99439 mRNA. Translation: AAA61195.1. |
| IPI | IPI00446767. IPI00749371. IPI00877770. |
| PIR | T47149. |
| RefSeq | NP_008936.2. NM_007005.3. |
| UniGene | Hs.444213. |
3D structure databases | |
| ProteinModelPortal | Q04727. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q04727. 3 interactions. |
PTM databases | |
| PhosphoSite | Q04727. |
Polymorphism databases | |
| DMDM | 158518541. |
Proteomic databases | |
| PaxDb | Q04727. |
| PRIDE | Q04727. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000376537; ENSP00000365720; ENSG00000106829. ENST00000376552; ENSP00000365735; ENSG00000106829. ENST00000461758; ENSP00000417906; ENSG00000106829. |
| GeneID | 7091. |
| KEGG | hsa:7091. |
| UCSC | uc004alc.3. human. uc004ald.3. human. uc010mps.3. human. |
Organism-specific databases | |
| CTD | 7091. |
| GeneCards | GC09P082186. |
| HGNC | HGNC:11840. TLE4. |
| MIM | 605132. gene. |
| neXtProt | NX_Q04727. |
| PharmGKB | PA36542. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2319. |
| HOVERGEN | HBG004689. |
| OMA | GLQRWFC. |
| OrthoDB | EOG4MGS6V. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | Q04727. |
| Bgee | Q04727. |
| Genevestigator | Q04727. |
| GermOnline | ENSG00000106829. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.130.10.10. 1 hit. |
| InterPro | IPR005617. Groucho/TLE_N. IPR009146. Groucho_enhance. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_dom. [Graphical view] |
| Pfam | PF03920. TLE_N. 1 hit. PF00400. WD40. 6 hits. [Graphical view] |
| PRINTS | PR01850. GROUCHOFAMLY. |
| SMART | SM00320. WD40. 7 hits. [Graphical view] |
| SUPFAM | SSF50978. WD40_like. 1 hit. |
| PROSITE | PS00678. WD_REPEATS_1. 2 hits. PS50082. WD_REPEATS_2. 3 hits. PS50294. WD_REPEATS_REGION. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 7091. |
| NextBio | 27739. |
| SOURCE | Search... |
Entry information
| Entry name | TLE4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q04727 Secondary accession number(s): Q3ZCS1 Q9ULF9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
