Q04725 (TLE2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transducin-like enhancer protein 2 Alternative name(s): Enhancer of split groucho-like protein 2 Short name=ESG2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 743 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES By similarity. |
| Subunit structure | Homooligomer and heterooligomer with other family members. Binds LEF1, TCF7, TCF7L1, TCF7L2, UTY, HES1 and HES5. Ref.5 |
| Subcellular location | |
| Tissue specificity | In all tissues examined, mostly in heart, brain, and muscle. |
| Post-translational modification | Ubiquitinated by XIAP/BIRC4. Ref.10 |
| Sequence similarities | Belongs to the WD repeat Groucho/TLE family. Contains 6 WD repeats. |
| Sequence caution | The sequence AK308137 differs from that shown. Reason: Frameshift at position 537. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DDB1 | Q16531 | 2 | EBI-1176061,EBI-350322 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q04725-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q04725-2) The sequence of this isoform differs from the canonical sequence as follows: 1-55: Missing. 124-190: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q04725-3) The sequence of this isoform differs from the canonical sequence as follows: 1-8: MYPQGRHP → MVQSRLTATSASQDSPASGLQ 124-124: Q → QQ 683-743: GRWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISRNNKYIVTGSGDKKATVYEVVY → VQGVVLSPEL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 743 | 743 | Transducin-like enhancer protein 2 | PRO_0000051278 | |||||
Regions | |||||||||
| Repeat | 455 – 493 | 39 | WD 1 | ||||||
| Repeat | 501 – 540 | 40 | WD 2 | ||||||
| Repeat | 545 – 584 | 40 | WD 3 | ||||||
| Repeat | 587 – 626 | 40 | WD 4 | ||||||
| Repeat | 669 – 708 | 40 | WD 5 | ||||||
| Repeat | 710 – 742 | 33 | WD 6 | ||||||
| Region | 195 – 256 | 62 | CCN domain | ||||||
| Motif | 214 – 217 | 4 | Nuclear localization signal Potential | ||||||
| Compositional bias | 1 – 133 | 133 | Gln-rich | ||||||
| Compositional bias | 134 – 194 | 61 | Gly/Pro-rich | ||||||
| Compositional bias | 257 – 398 | 142 | Pro/Ser-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 228 | 1 | Phosphoserine; by CK2 Potential | ||||||
| Modified residue | 249 | 1 | Phosphoserine; by CDK1 Potential | ||||||
| Modified residue | 253 | 1 | Phosphothreonine; by CDK1 Potential | ||||||
| Modified residue | 281 | 1 | Phosphoserine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 55 | 55 | Missing in isoform 2. | VSP_045693 | |||||
| Alternative sequence | 1 – 8 | 8 | MYPQGRHP → MVQSRLTATSASQDSPASGL Q in isoform 3. | VSP_046162 | |||||
| Alternative sequence | 124 – 190 | 67 | Missing in isoform 2. | VSP_045694 | |||||
| Alternative sequence | 124 | 1 | Q → QQ in isoform 3. | VSP_046163 | |||||
| Alternative sequence | 683 – 743 | 61 | GRWFV…YEVVY → VQGVVLSPEL in isoform 3. | VSP_046164 | |||||
| Natural variant | 381 | 1 | S → G. Ref.2 Corresponds to variant rs199788562 [ dbSNP | Ensembl ]. | VAR_069063 | |||||
Experimental info | |||||||||
| Sequence conflict | 280 | 1 | G → R in AAA61193. Ref.1 | ||||||
| Sequence conflict | 328 | 1 | A → L in AAA61193. Ref.1 | ||||||
| Sequence conflict | 441 | 1 | G → D in AAA61193. Ref.1 | ||||||
| Sequence conflict | 495 | 1 | A → R in AAA61193. Ref.1 | ||||||
| Sequence conflict | 636 – 637 | 2 | LG → PC in AAA61193. Ref.1 | ||||||
| Sequence conflict | 660 | 1 | R → G in AAA61193. Ref.1 | ||||||
| Sequence conflict | 681 | 1 | S → P in AAA61193. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human homologs of a Drosophila enhancer of split gene product define a novel family of nuclear proteins." Stifani S., Blaumueller C.M., Redhead N.J., Hill R.E., Artavanis-Tsakonas S. Nat. Genet. 2:119-127(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Fetal brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT GLY-381. Tissue: Brain and Urinary bladder. |
| [3] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [5] | "Transducin-like Enhancer of split 2, a mammalian homologue of Drosophila Groucho, acts as a transcriptional repressor, interacts with Hairy/Enhancer of split proteins, and is expressed during neuronal development." Grbavec D., Lo R., Liu Y., Stifani S. Eur. J. Biochem. 258:339-349(1998) [PubMed] [Europe PMC] [Abstract] Cited for: OLIGOMERIZATION, INTERACTION WITH HES1 AND HES5. |
| [6] | "Groucho/transducin-like enhancer of split (TLE) family members interact with the yeast transcriptional co-repressor SSN6 and mammalian SSN6-related proteins: implications for evolutionary conservation of transcription repression mechanisms." Grbavec D., Lo R., Liu Y., Greenfield A., Stifani S. Biochem. J. 337:13-17(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH UTY. |
| [7] | "All Tcf HMG box transcription factors interact with Groucho-related co-repressors." Brantjes H., Roose J., van De Wetering M., Clevers H. Nucleic Acids Res. 29:1410-1419(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH LEF1; TCF7; TCF7L1 AND TCF7L2. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-281, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [10] | "XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling." Hanson A.J., Wallace H.A., Freeman T.J., Beauchamp R.D., Lee L.A., Lee E. Mol. Cell 45:619-628(2012) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION BY XIAP/BIRC4. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M99436 mRNA. Translation: AAA61193.1. AK293407 mRNA. Translation: BAG56914.1. AK308137 mRNA. No translation available. AC007766 Genomic DNA. Translation: AAD38075.1. AC011549 Genomic DNA. No translation available. AC093053 Genomic DNA. No translation available. BC017364 mRNA. Translation: AAH17364.1. |
| IPI | IPI00297659. IPI00910233. IPI00921163. |
| PIR | C56695. |
| RefSeq | NP_001138233.1. NM_001144761.1. NP_001138234.1. NM_001144762.1. NP_003251.2. NM_003260.4. |
| UniGene | Hs.332173. |
3D structure databases | |
| ProteinModelPortal | Q04725. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q04725. 2 interactions. |
| STRING | 9606.ENSP00000262953. |
PTM databases | |
| PhosphoSite | Q04725. |
Polymorphism databases | |
| DMDM | 20532416. |
Proteomic databases | |
| PaxDb | Q04725. |
| PRIDE | Q04725. |
Protocols and materials databases | |
| DNASU | 7089. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000262953; ENSP00000262953; ENSG00000065717. ENST00000426948; ENSP00000392869; ENSG00000065717. ENST00000443826; ENSP00000392427; ENSG00000065717. ENST00000455444; ENSP00000413107; ENSG00000065717. ENST00000591529; ENSP00000468279; ENSG00000065717. |
| GeneID | 7089. |
| KEGG | hsa:7089. |
| UCSC | uc002lww.3. human. uc010dti.3. human. uc010xhc.2. human. |
Organism-specific databases | |
| CTD | 7089. |
| GeneCards | GC19M002997. |
| HGNC | HGNC:11838. TLE2. |
| HPA | HPA049103. |
| MIM | 601041. gene. |
| neXtProt | NX_Q04725. |
| PharmGKB | PA36540. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2319. |
| HOGENOM | HOG000293211. |
| HOVERGEN | HBG004689. |
| InParanoid | Q04725. |
| OMA | EEDKSDY. |
| OrthoDB | EOG4WQ121. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
| SignaLink | Q04725. |
Gene expression databases | |
| ArrayExpress | Q04725. |
| Bgee | Q04725. |
| CleanEx | HS_TLE2. |
| Genevestigator | Q04725. |
| GermOnline | ENSG00000065717. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.130.10.10. 1 hit. |
| InterPro | IPR005617. Groucho/TLE_N. IPR009146. Groucho_enhance. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_dom. [Graphical view] |
| Pfam | PF03920. TLE_N. 1 hit. PF00400. WD40. 5 hits. [Graphical view] |
| PRINTS | PR01850. GROUCHOFAMLY. |
| SMART | SM00320. WD40. 7 hits. [Graphical view] |
| SUPFAM | SSF50978. WD40_like. 1 hit. |
| PROSITE | PS00678. WD_REPEATS_1. 1 hit. PS50082. WD_REPEATS_2. 3 hits. PS50294. WD_REPEATS_REGION. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 7089. |
| NextBio | 27727. |
| SOURCE | Search... |
Entry information
| Entry name | TLE2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q04725 Secondary accession number(s): B4DE03 Q9Y6S0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
