Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q04725

- TLE2_HUMAN

UniProt

Q04725 - TLE2_HUMAN

Protein

Transducin-like enhancer protein 2

Gene

TLE2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 140 (01 Oct 2014)
      Sequence version 2 (10 May 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES By similarity.By similarity

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. transcription corepressor activity Source: UniProtKB

    GO - Biological processi

    1. negative regulation of canonical Wnt signaling pathway Source: UniProtKB
    2. negative regulation of transcription, DNA-templated Source: UniProtKB
    3. Notch signaling pathway Source: Reactome
    4. organ morphogenesis Source: ProtInc
    5. signal transduction Source: ProtInc
    6. transcription, DNA-templated Source: UniProtKB-KW
    7. Wnt signaling pathway Source: UniProtKB-KW

    Keywords - Molecular functioni

    Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation, Wnt signaling pathway

    Enzyme and pathway databases

    ReactomeiREACT_118780. NOTCH1 Intracellular Domain Regulates Transcription.
    REACT_200731. deactivation of the beta-catenin transactivating complex.
    REACT_200753. formation of the beta-catenin:TCF transactivating complex.
    SignaLinkiQ04725.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transducin-like enhancer protein 2
    Alternative name(s):
    Enhancer of split groucho-like protein 2
    Short name:
    ESG2
    Gene namesi
    Name:TLE2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:11838. TLE2.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular space Source: UniProt
    2. nucleoplasm Source: Reactome
    3. nucleus Source: ProtInc

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA36540.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 743743Transducin-like enhancer protein 2PRO_0000051278Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei228 – 2281Phosphoserine; by CK2Sequence Analysis
    Modified residuei249 – 2491Phosphoserine; by CDK1Sequence Analysis
    Modified residuei253 – 2531Phosphothreonine; by CDK1Sequence Analysis
    Modified residuei281 – 2811Phosphoserine1 Publication

    Post-translational modificationi

    Ubiquitinated by XIAP/BIRC4.1 Publication

    Keywords - PTMi

    Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiQ04725.
    PaxDbiQ04725.
    PRIDEiQ04725.

    PTM databases

    PhosphoSiteiQ04725.

    Expressioni

    Tissue specificityi

    In all tissues examined, mostly in heart, brain, and muscle.

    Gene expression databases

    ArrayExpressiQ04725.
    BgeeiQ04725.
    CleanExiHS_TLE2.
    GenevestigatoriQ04725.

    Organism-specific databases

    HPAiHPA049103.

    Interactioni

    Subunit structurei

    Homooligomer and heterooligomer with other family members. Binds LEF1, TCF7, TCF7L1, TCF7L2, UTY, HES1 and HES5.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    DDB1Q165312EBI-1176061,EBI-350322

    Protein-protein interaction databases

    BioGridi112944. 19 interactions.
    IntActiQ04725. 3 interactions.
    STRINGi9606.ENSP00000262953.

    Structurei

    3D structure databases

    ProteinModelPortaliQ04725.
    SMRiQ04725. Positions 414-743.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati455 – 49339WD 1Add
    BLAST
    Repeati501 – 54040WD 2Add
    BLAST
    Repeati545 – 58440WD 3Add
    BLAST
    Repeati587 – 62640WD 4Add
    BLAST
    Repeati669 – 70840WD 5Add
    BLAST
    Repeati710 – 74233WD 6Add
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni195 – 25662CCN domainAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi214 – 2174Nuclear localization signalSequence Analysis

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1 – 133133Gln-richAdd
    BLAST
    Compositional biasi134 – 19461Gly/Pro-richAdd
    BLAST
    Compositional biasi257 – 398142Pro/Ser-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the WD repeat Groucho/TLE family.Curated
    Contains 6 WD repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, WD repeat

    Phylogenomic databases

    eggNOGiCOG2319.
    HOGENOMiHOG000293211.
    HOVERGENiHBG004689.
    InParanoidiQ04725.
    OrthoDBiEOG7HQNC3.
    PhylomeDBiQ04725.
    TreeFamiTF314167.

    Family and domain databases

    Gene3Di2.130.10.10. 1 hit.
    InterProiIPR005617. Groucho/TLE_N.
    IPR009146. Groucho_enhance.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF03920. TLE_N. 1 hit.
    PF00400. WD40. 5 hits.
    [Graphical view]
    PRINTSiPR01850. GROUCHOFAMLY.
    SMARTiSM00320. WD40. 7 hits.
    [Graphical view]
    SUPFAMiSSF50978. SSF50978. 1 hit.
    PROSITEiPS00678. WD_REPEATS_1. 1 hit.
    PS50082. WD_REPEATS_2. 3 hits.
    PS50294. WD_REPEATS_REGION. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q04725-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MYPQGRHPTP LQSGQPFKFS ILEICDRIKE EFQFLQAQYH SLKLECEKLA    50
    SEKTEMQRHY VMYYEMSYGL NIEMHKQAEI VKRLSGICAQ IIPFLTQEHQ 100
    QQVLQAVERA KQVTVGELNS LIGQQLQPLS HHAPPVPLTP RPAGLVGGSA 150
    TGLLALSGAL AAQAQLAAAV KEDRAGVEAE GSRVERAPSR SASPSPPESL 200
    VEEERPSGPG GGGKQRADEK EPSGPYESDE DKSDYNLVVD EDQPSEPPSP 250
    ATTPCGKVPI CIPARRDLVD SPASLASSLG SPLPRAKELI LNDLPASTPA 300
    SKSCDSSPPQ DASTPGPSSA SHLCQLAAKP APSTDSVALR SPLTLSSPFT 350
    TSFSLGSHST LNGDLSVPSS YVSLHLSPQV SSSVVYGRSP VMAFESHPHL 400
    RGSSVSSSLP SIPGGKPAYS FHVSADGQMQ PVPFPSDALV GAGIPRHARQ 450
    LHTLAHGEVV CAVTISGSTQ HVYTGGKGCV KVWDVGQPGA KTPVAQLDCL 500
    NRDNYIRSCK LLPDGRSLIV GGEASTLSIW DLAAPTPRIK AELTSSAPAC 550
    YALAVSPDAK VCFSCCSDGN IVVWDLQNQT MVRQFQGHTD GASCIDISDY 600
    GTRLWTGGLD NTVRCWDLRE GRQLQQHDFS SQIFSLGHCP NQDWLAVGME 650
    SSNVEILHVR KPEKYQLHLH ESCVLSLKFA SCGRWFVSTG KDNLLNAWRT 700
    PYGASIFQSK ESSSVLSCDI SRNNKYIVTG SGDKKATVYE VVY 743
    Length:743
    Mass (Da):79,841
    Last modified:May 10, 2002 - v2
    Checksum:i5E3DBFAB67278219
    GO
    Isoform 2 (identifier: Q04725-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-55: Missing.
         124-190: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:621
    Mass (Da):66,678
    Checksum:iF5100FF0B0FECFBA
    GO
    Isoform 3 (identifier: Q04725-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-8: MYPQGRHP → MVQSRLTATSASQDSPASGLQ
         124-124: Q → QQ
         683-743: GRWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISRNNKYIVTGSGDKKATVYEVVY → VQGVVLSPEL

    Note: No experimental confirmation available.

    Show »
    Length:706
    Mass (Da):75,364
    Checksum:i71A2BA068112A6AE
    GO

    Sequence cautioni

    The sequence AK308137 differs from that shown. Reason: Frameshift at position 537.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti280 – 2801G → R in AAA61193. (PubMed:1303260)Curated
    Sequence conflicti328 – 3281A → L in AAA61193. (PubMed:1303260)Curated
    Sequence conflicti441 – 4411G → D in AAA61193. (PubMed:1303260)Curated
    Sequence conflicti495 – 4951A → R in AAA61193. (PubMed:1303260)Curated
    Sequence conflicti636 – 6372LG → PC in AAA61193. (PubMed:1303260)Curated
    Sequence conflicti660 – 6601R → G in AAA61193. (PubMed:1303260)Curated
    Sequence conflicti681 – 6811S → P in AAA61193. (PubMed:1303260)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti381 – 3811S → G.1 Publication
    Corresponds to variant rs199788562 [ dbSNP | Ensembl ].
    VAR_069063

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5555Missing in isoform 2. 1 PublicationVSP_045693Add
    BLAST
    Alternative sequencei1 – 88MYPQGRHP → MVQSRLTATSASQDSPASGL Q in isoform 3. 1 PublicationVSP_046162
    Alternative sequencei124 – 19067Missing in isoform 2. 1 PublicationVSP_045694Add
    BLAST
    Alternative sequencei124 – 1241Q → QQ in isoform 3. 1 PublicationVSP_046163
    Alternative sequencei683 – 74361GRWFV…YEVVY → VQGVVLSPEL in isoform 3. 1 PublicationVSP_046164Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M99436 mRNA. Translation: AAA61193.1.
    AK293407 mRNA. Translation: BAG56914.1.
    AK308137 mRNA. No translation available.
    AC007766 Genomic DNA. Translation: AAD38075.1.
    AC011549 Genomic DNA. No translation available.
    AC093053 Genomic DNA. No translation available.
    BC017364 mRNA. Translation: AAH17364.1.
    CCDSiCCDS45911.1. [Q04725-1]
    CCDS45912.1. [Q04725-2]
    CCDS45913.1. [Q04725-3]
    PIRiC56695.
    RefSeqiNP_001138233.1. NM_001144761.1. [Q04725-3]
    NP_001138234.1. NM_001144762.1. [Q04725-2]
    NP_003251.2. NM_003260.4. [Q04725-1]
    UniGeneiHs.332173.

    Genome annotation databases

    GeneIDi7089.
    KEGGihsa:7089.
    UCSCiuc002lww.3. human. [Q04725-1]
    uc010dti.3. human.
    uc010xhc.2. human.

    Polymorphism databases

    DMDMi20532416.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M99436 mRNA. Translation: AAA61193.1 .
    AK293407 mRNA. Translation: BAG56914.1 .
    AK308137 mRNA. No translation available.
    AC007766 Genomic DNA. Translation: AAD38075.1 .
    AC011549 Genomic DNA. No translation available.
    AC093053 Genomic DNA. No translation available.
    BC017364 mRNA. Translation: AAH17364.1 .
    CCDSi CCDS45911.1. [Q04725-1 ]
    CCDS45912.1. [Q04725-2 ]
    CCDS45913.1. [Q04725-3 ]
    PIRi C56695.
    RefSeqi NP_001138233.1. NM_001144761.1. [Q04725-3 ]
    NP_001138234.1. NM_001144762.1. [Q04725-2 ]
    NP_003251.2. NM_003260.4. [Q04725-1 ]
    UniGenei Hs.332173.

    3D structure databases

    ProteinModelPortali Q04725.
    SMRi Q04725. Positions 414-743.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112944. 19 interactions.
    IntActi Q04725. 3 interactions.
    STRINGi 9606.ENSP00000262953.

    PTM databases

    PhosphoSitei Q04725.

    Polymorphism databases

    DMDMi 20532416.

    Proteomic databases

    MaxQBi Q04725.
    PaxDbi Q04725.
    PRIDEi Q04725.

    Protocols and materials databases

    DNASUi 7089.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 7089.
    KEGGi hsa:7089.
    UCSCi uc002lww.3. human. [Q04725-1 ]
    uc010dti.3. human.
    uc010xhc.2. human.

    Organism-specific databases

    CTDi 7089.
    GeneCardsi GC19M002997.
    HGNCi HGNC:11838. TLE2.
    HPAi HPA049103.
    MIMi 601041. gene.
    neXtProti NX_Q04725.
    PharmGKBi PA36540.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2319.
    HOGENOMi HOG000293211.
    HOVERGENi HBG004689.
    InParanoidi Q04725.
    OrthoDBi EOG7HQNC3.
    PhylomeDBi Q04725.
    TreeFami TF314167.

    Enzyme and pathway databases

    Reactomei REACT_118780. NOTCH1 Intracellular Domain Regulates Transcription.
    REACT_200731. deactivation of the beta-catenin transactivating complex.
    REACT_200753. formation of the beta-catenin:TCF transactivating complex.
    SignaLinki Q04725.

    Miscellaneous databases

    GeneWikii TLE2.
    GenomeRNAii 7089.
    NextBioi 27727.
    PROi Q04725.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q04725.
    Bgeei Q04725.
    CleanExi HS_TLE2.
    Genevestigatori Q04725.

    Family and domain databases

    Gene3Di 2.130.10.10. 1 hit.
    InterProi IPR005617. Groucho/TLE_N.
    IPR009146. Groucho_enhance.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF03920. TLE_N. 1 hit.
    PF00400. WD40. 5 hits.
    [Graphical view ]
    PRINTSi PR01850. GROUCHOFAMLY.
    SMARTi SM00320. WD40. 7 hits.
    [Graphical view ]
    SUPFAMi SSF50978. SSF50978. 1 hit.
    PROSITEi PS00678. WD_REPEATS_1. 1 hit.
    PS50082. WD_REPEATS_2. 3 hits.
    PS50294. WD_REPEATS_REGION. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Human homologs of a Drosophila enhancer of split gene product define a novel family of nuclear proteins."
      Stifani S., Blaumueller C.M., Redhead N.J., Hill R.E., Artavanis-Tsakonas S.
      Nat. Genet. 2:119-127(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Fetal brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT GLY-381.
      Tissue: Brain and Urinary bladder.
    3. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.
    5. "Transducin-like Enhancer of split 2, a mammalian homologue of Drosophila Groucho, acts as a transcriptional repressor, interacts with Hairy/Enhancer of split proteins, and is expressed during neuronal development."
      Grbavec D., Lo R., Liu Y., Stifani S.
      Eur. J. Biochem. 258:339-349(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: OLIGOMERIZATION, INTERACTION WITH HES1 AND HES5.
    6. "Groucho/transducin-like enhancer of split (TLE) family members interact with the yeast transcriptional co-repressor SSN6 and mammalian SSN6-related proteins: implications for evolutionary conservation of transcription repression mechanisms."
      Grbavec D., Lo R., Liu Y., Greenfield A., Stifani S.
      Biochem. J. 337:13-17(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH UTY.
    7. "All Tcf HMG box transcription factors interact with Groucho-related co-repressors."
      Brantjes H., Roose J., van De Wetering M., Clevers H.
      Nucleic Acids Res. 29:1410-1419(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH LEF1; TCF7; TCF7L1 AND TCF7L2.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-281, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    10. "XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling."
      Hanson A.J., Wallace H.A., Freeman T.J., Beauchamp R.D., Lee L.A., Lee E.
      Mol. Cell 45:619-628(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: UBIQUITINATION BY XIAP/BIRC4.

    Entry informationi

    Entry nameiTLE2_HUMAN
    AccessioniPrimary (citable) accession number: Q04725
    Secondary accession number(s): B4DE03
    , E9PEV7, F8WCH2, Q8WVY0, Q9Y6S0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1994
    Last sequence update: May 10, 2002
    Last modified: October 1, 2014
    This is version 140 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3