Q04646 (ATNG_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sodium/potassium-transporting ATPase subunit gamma Short name=Na(+)/K(+) ATPase subunit gamma Alternative name(s): FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 70 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase. |
| Subunit structure | Composed of three subunits: alpha (catalytic), beta and gamma. |
| Subcellular location | Membrane; Single-pass type III membrane protein Potential. |
| Tissue specificity | Highest levels expressed in the kidney and spleen. Restricted to the basolateral membrane in renal epithelial cells and varies in its level of expression along the nephron. |
| Sequence similarities | Belongs to the FXYD family. |
| Sequence caution | The sequence CAA49664.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Potassium transport Sodium transport Sodium/potassium transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Potassium Sodium |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | potassium ion transport Inferred from electronic annotation. Source: UniProtKB-KW sodium ion transportInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | ion channel activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q04646-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q04646-2) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 1-12: MAGEISDLSANS → MDRWYL | ||||||
| Isoform 3 (identifier: Q04646-3) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 1-11: MAGEISDLSAN → MQINTKRRKRCWSLKFDALDSGWKPHKALGCWAAESCCRKTG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 70 | 70 | Sodium/potassium-transporting ATPase subunit gamma | PRO_0000148186 | |||||
Regions | |||||||||
| Transmembrane | 33 – 50 | 18 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 12 | 12 | MAGEI…LSANS → MDRWYL in isoform 2. | VSP_001581 | |||||
| Alternative sequence | 1 – 11 | 11 | MAGEISDLSAN → MQINTKRRKRCWSLKFDALD SGWKPHKALGCWAAESCCRK TG in isoform 3. | VSP_001582 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The mouse Na+-K+-ATPase gamma-subunit gene (Fxyd2) encodes three developmentally regulated transcripts." Jones D.H., Golding M.C., Barr K.J., Fong G.-H., Kidder G.M. Physiol. Genomics 6:129-135(2001) [PubMed: 11526196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2 AND 3). Strain: 129/Sv. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Kidney. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: FVB/N. Tissue: Kidney. |
| [4] | "Molecular cloning and immunological characterization of the gamma polypeptide, a small protein associated with the Na,K-ATPase." Mercer R.W., Biemesderfer D., Bliss D.P. Jr., Collins J.H., Forbush B. III J. Cell Biol. 121:579-586(1993) [PubMed: 8387529] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 18-70. Tissue: Kidney. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY035583 Genomic DNA. Translation: AAK62036.1. AY035583 Genomic DNA. Translation: AAK62037.1. AY035583 Genomic DNA. Translation: AAK62038.1. AK002215 mRNA. Translation: BAC24981.1. BC024614 mRNA. Translation: AAH24614.1. X70060 mRNA. Translation: CAA49664.1. Different initiation. |
| IPI | IPI00108584. IPI00227916. IPI00227917. |
| PIR | C46435. |
| RefSeq | NP_031529.2. NM_007503.3. NP_439888.1. NM_052823.2. |
| UniGene | Mm.22742. |
3D structure databases | |
| ProteinModelPortal | Q04646. |
| SMR | Q04646. Positions 27-55. |
| ModBase | Search... |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000041005; ENSMUSP00000035429; ENSMUSG00000059412. |
| GeneID | 11936. |
| KEGG | mmu:11936. |
Organism-specific databases | |
| CTD | 486. |
| MGI | MGI:1195260. Fxyd2. |
Phylogenomic databases | |
| GeneTree | ENSGT00530000064417. |
| HOVERGEN | HBG100880. |
| OrthoDB | EOG45HS03. |
Gene expression databases | |
| Bgee | Q04646. |
| CleanEx | MM_FXYD2. |
| Genevestigator | Q04646. |
Family and domain databases | |
| InterPro | IPR000272. Ion-transport_regulator_FXYD. [Graphical view] |
| KO | K01538. |
| Pfam | PF02038. ATP1G1_PLM_MAT8. 1 hit. [Graphical view] |
| ProDom | PD005989. PD005989. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| PROSITE | PS01310. FXYD. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 280029. |
| SOURCE | Search... |
Entry information
| Entry name | ATNG_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q04646 Secondary accession number(s): Q923I2, Q923I3, Q923I4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with