Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/potassium-transporting ATPase subunit gamma

Gene

Fxyd2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

GO - Molecular functioni

  • ion channel activity Source: InterPro
  • sodium:potassium-exchanging ATPase activity Source: Ensembl
  • sodium channel regulator activity Source: MGI

GO - Biological processi

  • regulation of cell growth Source: Ensembl
  • regulation of cell proliferation Source: Ensembl
  • regulation of sodium ion transmembrane transporter activity Source: MGI

Keywordsi

Biological processIon transport, Potassium transport, Sodium transport, Sodium/potassium transport, Transport
LigandPotassium, Sodium

Enzyme and pathway databases

ReactomeiR-MMU-5578775 Ion homeostasis
R-MMU-936837 Ion transport by P-type ATPases

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/potassium-transporting ATPase subunit gamma
Short name:
Na(+)/K(+) ATPase subunit gamma
Alternative name(s):
FXYD domain-containing ion transport regulator 2
Sodium pump gamma chain
Gene namesi
Name:Fxyd2
Synonyms:Atp1c, Atp1g1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:1195260 Fxyd2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei33 – 50HelicalSequence analysisAdd BLAST18

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001481861 – 70Sodium/potassium-transporting ATPase subunit gammaAdd BLAST70

Proteomic databases

MaxQBiQ04646
PaxDbiQ04646
PeptideAtlasiQ04646
PRIDEiQ04646

Expressioni

Tissue specificityi

Highest levels expressed in the kidney and spleen. Restricted to the basolateral membrane in renal epithelial cells and varies in its level of expression along the nephron.

Gene expression databases

BgeeiENSMUSG00000059412
CleanExiMM_FXYD2
ExpressionAtlasiQ04646 baseline and differential
GenevisibleiQ04646 MM

Interactioni

Subunit structurei

Regulatory subunit of the sodium/potassium-transporting ATPase which is composed of a catalytic alpha subunit, an auxiliary non-catalytic beta subunit and an additional regulatory subunit.By similarity

Protein-protein interaction databases

CORUMiQ04646
STRINGi10090.ENSMUSP00000035429

Structurei

3D structure databases

ProteinModelPortaliQ04646
SMRiQ04646
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FXYD family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J35I Eukaryota
ENOG410Z10F LUCA
GeneTreeiENSGT00530000063932
HOGENOMiHOG000234468
HOVERGENiHBG100880
InParanoidiQ04646
KOiK01538
OMAiDRWYLGG
PhylomeDBiQ04646

Family and domain databases

InterProiView protein in InterPro
IPR000272 Ion-transport_regulator_FXYD
PfamiView protein in Pfam
PF02038 ATP1G1_PLM_MAT8, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD005989 PD005989, 1 hit
PROSITEiView protein in PROSITE
PS01310 FXYD, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q04646-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGEISDLSA NSGGSAKGTE NPFEYDYETV RKGGLIFAGL AFVVGLLIIL
60 70
SKRFRCGGGK KHRQVNEDEL
Length:70
Mass (Da):7,520
Last modified:January 23, 2002 - v2
Checksum:i7114553B004A3422
GO
Isoform 2 (identifier: Q04646-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MAGEISDLSANS → MDRWYL

Show »
Length:64
Mass (Da):7,208
Checksum:iF69EA9B9910250B7
GO
Isoform 3 (identifier: Q04646-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MAGEISDLSAN → MQINTKRRKRCWSLKFDALDSGWKPHKALGCWAAESCCRKTG

Show »
Length:101
Mass (Da):11,281
Checksum:i090346D9FC2658A6
GO

Sequence cautioni

The sequence CAA49664 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0015811 – 12MAGEI…LSANS → MDRWYL in isoform 2. CuratedAdd BLAST12
Alternative sequenceiVSP_0015821 – 11MAGEISDLSAN → MQINTKRRKRCWSLKFDALD SGWKPHKALGCWAAESCCRK TG in isoform 3. CuratedAdd BLAST11

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY035583 Genomic DNA Translation: AAK62036.1
AY035583 Genomic DNA Translation: AAK62037.1
AY035583 Genomic DNA Translation: AAK62038.1
AK002215 mRNA Translation: BAC24981.1
BC024614 mRNA Translation: AAH24614.1
X70060 mRNA Translation: CAA49664.1 Different initiation.
CCDSiCCDS23134.1 [Q04646-2]
PIRiC46435
RefSeqiNP_031529.2, NM_007503.3 [Q04646-1]
NP_439888.1, NM_052823.2 [Q04646-2]
UniGeneiMm.22742

Genome annotation databases

EnsembliENSMUST00000041005; ENSMUSP00000035429; ENSMUSG00000059412 [Q04646-2]
GeneIDi11936
KEGGimmu:11936
UCSCiuc009pfv.1 mouse [Q04646-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiATNG_MOUSE
AccessioniPrimary (citable) accession number: Q04646
Secondary accession number(s): Q923I2, Q923I3, Q923I4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: January 23, 2002
Last modified: April 25, 2018
This is version 134 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome