Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/potassium-transporting ATPase subunit gamma

Gene

Fxyd2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

GO - Molecular functioni

  • ion channel activity Source: InterPro
  • sodium:potassium-exchanging ATPase activity Source: Ensembl
  • sodium channel regulator activity Source: MGI

GO - Biological processi

  • regulation of cell growth Source: Ensembl
  • regulation of cell proliferation Source: Ensembl
  • regulation of sodium ion transmembrane transporter activity Source: MGI
Complete GO annotation...

Keywords - Biological processi

Ion transport, Potassium transport, Sodium transport, Sodium/potassium transport, Transport

Keywords - Ligandi

Potassium, Sodium

Enzyme and pathway databases

ReactomeiR-MMU-5578775. Ion homeostasis.
R-MMU-936837. Ion transport by P-type ATPases.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/potassium-transporting ATPase subunit gamma
Short name:
Na(+)/K(+) ATPase subunit gamma
Alternative name(s):
FXYD domain-containing ion transport regulator 2
Sodium pump gamma chain
Gene namesi
Name:Fxyd2
Synonyms:Atp1c, Atp1g1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:1195260. Fxyd2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei33 – 5018HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 7070Sodium/potassium-transporting ATPase subunit gammaPRO_0000148186Add
BLAST

Proteomic databases

MaxQBiQ04646.
PaxDbiQ04646.
PeptideAtlasiQ04646.
PRIDEiQ04646.

Expressioni

Tissue specificityi

Highest levels expressed in the kidney and spleen. Restricted to the basolateral membrane in renal epithelial cells and varies in its level of expression along the nephron.

Gene expression databases

BgeeiENSMUSG00000059412.
CleanExiMM_FXYD2.
ExpressionAtlasiQ04646. baseline and differential.
GenevisibleiQ04646. MM.

Interactioni

Subunit structurei

Composed of three subunits: alpha (catalytic), beta and gamma.

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000035429.

Structurei

3D structure databases

ProteinModelPortaliQ04646.
SMRiQ04646. Positions 27-55.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FXYD family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J35I. Eukaryota.
ENOG410Z10F. LUCA.
GeneTreeiENSGT00530000064417.
HOGENOMiHOG000234468.
HOVERGENiHBG100880.
InParanoidiQ04646.
KOiK01538.
OMAiDRWYLGG.
PhylomeDBiQ04646.

Family and domain databases

InterProiIPR000272. Ion-transport_regulator_FXYD.
[Graphical view]
PfamiPF02038. ATP1G1_PLM_MAT8. 1 hit.
[Graphical view]
ProDomiPD005989. PD005989. 1 hit.
[Graphical view] [Entries sharing at least one domain]
PROSITEiPS01310. FXYD. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q04646-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGEISDLSA NSGGSAKGTE NPFEYDYETV RKGGLIFAGL AFVVGLLIIL
60 70
SKRFRCGGGK KHRQVNEDEL
Length:70
Mass (Da):7,520
Last modified:January 23, 2002 - v2
Checksum:i7114553B004A3422
GO
Isoform 2 (identifier: Q04646-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MAGEISDLSANS → MDRWYL

Show »
Length:64
Mass (Da):7,208
Checksum:iF69EA9B9910250B7
GO
Isoform 3 (identifier: Q04646-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MAGEISDLSAN → MQINTKRRKRCWSLKFDALDSGWKPHKALGCWAAESCCRKTG

Show »
Length:101
Mass (Da):11,281
Checksum:i090346D9FC2658A6
GO

Sequence cautioni

The sequence CAA49664 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1212MAGEI…LSANS → MDRWYL in isoform 2. CuratedVSP_001581Add
BLAST
Alternative sequencei1 – 1111MAGEISDLSAN → MQINTKRRKRCWSLKFDALD SGWKPHKALGCWAAESCCRK TG in isoform 3. CuratedVSP_001582Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY035583 Genomic DNA. Translation: AAK62036.1.
AY035583 Genomic DNA. Translation: AAK62037.1.
AY035583 Genomic DNA. Translation: AAK62038.1.
AK002215 mRNA. Translation: BAC24981.1.
BC024614 mRNA. Translation: AAH24614.1.
X70060 mRNA. Translation: CAA49664.1. Different initiation.
CCDSiCCDS23134.1. [Q04646-2]
PIRiC46435.
RefSeqiNP_031529.2. NM_007503.3. [Q04646-1]
NP_439888.1. NM_052823.2. [Q04646-2]
UniGeneiMm.22742.

Genome annotation databases

EnsembliENSMUST00000041005; ENSMUSP00000035429; ENSMUSG00000059412. [Q04646-2]
GeneIDi11936.
KEGGimmu:11936.
UCSCiuc009pfv.1. mouse. [Q04646-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY035583 Genomic DNA. Translation: AAK62036.1.
AY035583 Genomic DNA. Translation: AAK62037.1.
AY035583 Genomic DNA. Translation: AAK62038.1.
AK002215 mRNA. Translation: BAC24981.1.
BC024614 mRNA. Translation: AAH24614.1.
X70060 mRNA. Translation: CAA49664.1. Different initiation.
CCDSiCCDS23134.1. [Q04646-2]
PIRiC46435.
RefSeqiNP_031529.2. NM_007503.3. [Q04646-1]
NP_439888.1. NM_052823.2. [Q04646-2]
UniGeneiMm.22742.

3D structure databases

ProteinModelPortaliQ04646.
SMRiQ04646. Positions 27-55.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000035429.

Proteomic databases

MaxQBiQ04646.
PaxDbiQ04646.
PeptideAtlasiQ04646.
PRIDEiQ04646.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000041005; ENSMUSP00000035429; ENSMUSG00000059412. [Q04646-2]
GeneIDi11936.
KEGGimmu:11936.
UCSCiuc009pfv.1. mouse. [Q04646-1]

Organism-specific databases

CTDi486.
MGIiMGI:1195260. Fxyd2.

Phylogenomic databases

eggNOGiENOG410J35I. Eukaryota.
ENOG410Z10F. LUCA.
GeneTreeiENSGT00530000064417.
HOGENOMiHOG000234468.
HOVERGENiHBG100880.
InParanoidiQ04646.
KOiK01538.
OMAiDRWYLGG.
PhylomeDBiQ04646.

Enzyme and pathway databases

ReactomeiR-MMU-5578775. Ion homeostasis.
R-MMU-936837. Ion transport by P-type ATPases.

Miscellaneous databases

ChiTaRSiFxyd2. mouse.
PROiQ04646.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000059412.
CleanExiMM_FXYD2.
ExpressionAtlasiQ04646. baseline and differential.
GenevisibleiQ04646. MM.

Family and domain databases

InterProiIPR000272. Ion-transport_regulator_FXYD.
[Graphical view]
PfamiPF02038. ATP1G1_PLM_MAT8. 1 hit.
[Graphical view]
ProDomiPD005989. PD005989. 1 hit.
[Graphical view] [Entries sharing at least one domain]
PROSITEiPS01310. FXYD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiATNG_MOUSE
AccessioniPrimary (citable) accession number: Q04646
Secondary accession number(s): Q923I2, Q923I3, Q923I4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: January 23, 2002
Last modified: September 7, 2016
This is version 123 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.