Reviewed,
UniProtKB/Swiss-Prot Q04499 (PROD_DROME)
Last modified
June 16, 2009.
Version 71.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Proline dehydrogenase, mitochondrial EC=1.5.99.8 Alternative name(s): Proline oxidase Protein sluggish-A | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) [Complete proteome] | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 681 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Converts proline to delta-1-pyrroline-5-carboxylate. Ref.1 |
| Catalytic activity | L-proline + acceptor = (S)-1-pyrroline-5-carboxylate + reduced acceptor. |
| Cofactor | FAD. |
| Pathway | |
| Subcellular location | |
| Tissue specificity | Most abundant in developing nervous system. Ref.1 |
| Developmental stage | Expressed in developing embryo as well as in adult. Ref.1 |
| Disruption phenotype | Flies exhibit reduced proline oxidase activity which produces sluggish behavior. Ref.1 |
| Sequence similarities | Belongs to the proline oxidase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Proline metabolism |
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Domain | Transit peptide |
| Ligand | FAD Flavoprotein |
| Molecular function | Oxidoreductase |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | glutamate biosynthetic process Inferred from electronic annotation. Source: InterPro oxidation reductionInferred from electronic annotation. Source: UniProtKB-KW phototaxisInferred from mutant phenotype. Source: FlyBase proline catabolic processInferred from electronic annotation. Source: InterPro |
| Cellular component | mitochondrial matrix Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | proline dehydrogenase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Q9W2I6 | 1 | EBI-197717,EBI-146309 | ||
| CG3403 | Q9V9B4 | 1 | EBI-197717,EBI-157547 | |
| CG6608 | Q9VGU9 | 1 | EBI-197717,EBI-190238 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform D (identifier: Q04499-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform A (identifier: Q04499-2) Also known as: F; The sequence of this isoform differs from the canonical sequence as follows: 158-192: LARNLLGQKLFVLLMKSSFYGHFVAGENRHTIVPA → WSKNVLGQRLFTLLMKATFYGHFVAGEDQIKIIPT 285-296: Missing. | ||||||
| Isoform B (identifier: Q04499-3) The sequence of this isoform differs from the canonical sequence as follows: 285-296: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform C (identifier: Q04499-4) The sequence of this isoform differs from the canonical sequence as follows: 1-325: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform E (identifier: Q04499-5) The sequence of this isoform differs from the canonical sequence as follows: 158-192: LARNLLGQKLFVLLMKSSFYGHFVAGENRHTIVPA → WSKNVLGQRLFTLLMKATFYGHFVAGEDQIKIIPT | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 30 | 30 | Mitochondrion Potential | ||||||
| Chain | 31 – 681 | 651 | Proline dehydrogenase, mitochondrial | PRO_0000025803 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 325 | 325 | Missing in isoform C. | VSP_015400 | |||||
| Alternative sequence | 158 – 192 | 35 | LARNL…TIVPA → WSKNVLGQRLFTLLMKATFY GHFVAGEDQIKIIPT in isoform A and isoform E. | VSP_015401 | |||||
| Alternative sequence | 285 – 296 | 12 | Missing in isoform A and isoform B. | VSP_015402 | |||||
Experimental info | |||||||||
| Sequence conflict | 42 | 1 | S → N in AAA02748. Ref.1 | ||||||
| Sequence conflict | 147 | 1 | K → N in AAA02748. Ref.1 | ||||||
| Sequence conflict | 149 | 1 | V → F in AAC28410. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The sluggish-A gene of Drosophila melanogaster is expressed in the nervous system and encodes proline oxidase, a mitochondrial enzyme involved in glutamate biosynthesis." Hayward D.C., Delaney S.J., Campbell H.D., Ghysen A., Benzer S., Kasprzak A.B., Cotsell J.N., Young I.G., Miklos G.L.G. Proc. Natl. Acad. Sci. U.S.A. 90:2979-2983(1993) [PubMed: 8096642] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, DISRUPTION PHENOTYPE. Strain: Canton-S. |
| [2] | "Data transferability from model organisms to human beings: insights from the functional genomics of the flightless region of Drosophila." Maleszka R., de Couet H.G., Miklos G.L.G. Proc. Natl. Acad. Sci. U.S.A. 95:3731-3736(1998) [PubMed: 9520435] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM A). Strain: Canton-S. |
| [3] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed: 10731132] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [4] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed: 12537572] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. |
| [5] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed: 12537569] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Strain: Berkeley. Tissue: Embryo. |
Cross-references
Sequence databases | |
|---|---|
| L07330 mRNA. Translation: AAA02748.1. AF017777 Genomic DNA. Translation: AAC28410.1. AE014298 Genomic DNA. Translation: AAF50814.2. AE014298 Genomic DNA. Translation: AAF50819.2. AE014298 Genomic DNA. Translation: AAF50820.2. AE014298 Genomic DNA. Translation: AAF50821.1. AE014298 Genomic DNA. Translation: AAF50822.3. AY069407 mRNA. Translation: AAL39552.1. | |
| PIR | A47302. |
| RefSeq | NP_523433.2. NP_728422.1. NP_728423.1. NP_728424.1. NP_728425.1. |
| UniGene | Dm.6612 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q04499. 20 interactions. |
Genome annotation databases | |
| Ensembl | FBgn0003423. Drosophila melanogaster. [Contig view] |
| GeneID | 33117. |
| KEGG | dme:Dmel_CG1417. |
Organism-specific databases | |
| FlyBase | FBgn0003423. slgA. |
Phylogenomic databases | |
| OMA | Q04499. MESCTSA. |
Enzyme and pathway databases | |
| BRENDA | 1.5.99.8. 48. |
Gene expression databases | |
| ArrayExpress | Q04499. |
| GermOnline | CG1417. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR002872. Proline_DH. IPR015659. Proline_oxidase. [Graphical view] |
| PANTHER | PTHR13914. Proline_oxidase. 1 hit. |
| Pfam | PF01619. Pro_dh. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 781979. |
Entry information
| Entry name | PROD_DROME | ||||||||
| Accession | Primary (citable) accession number: Q04499 Secondary accession number(s): O61349 Q9VRI2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with


