Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Proline dehydrogenase 1, mitochondrial

Gene

slgA

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Converts proline to delta-1-pyrroline-5-carboxylate.1 Publication

Catalytic activityi

L-proline + a quinone = (S)-1-pyrroline-5-carboxylate + a quinol.

Cofactori

Pathwayi: L-proline degradation into L-glutamate

This protein is involved in step 1 of the subpathway that synthesizes L-glutamate from L-proline.
Proteins known to be involved in the 2 steps of the subpathway in this organism are:
  1. Proline dehydrogenase 1, mitochondrial (slgA)
  2. no protein annotated in this organism
This subpathway is part of the pathway L-proline degradation into L-glutamate, which is itself part of Amino-acid degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes L-glutamate from L-proline, the pathway L-proline degradation into L-glutamate and in Amino-acid degradation.

GO - Molecular functioni

  • FAD binding Source: UniProtKB
  • proline dehydrogenase activity Source: FlyBase

GO - Biological processi

  • glutamate biosynthetic process Source: FlyBase
  • locomotory behavior Source: FlyBase
  • phototaxis Source: FlyBase
  • proline catabolic process Source: FlyBase
  • proline catabolic process to glutamate Source: GO_Central

Keywordsi

Molecular functionOxidoreductase
Biological processProline metabolism
LigandFAD, Flavoprotein

Enzyme and pathway databases

ReactomeiR-DME-70688. Proline catabolism.
UniPathwayiUPA00261; UER00373.

Names & Taxonomyi

Protein namesi
Recommended name:
Proline dehydrogenase 1, mitochondrial (EC:1.5.5.2)
Alternative name(s):
Proline oxidase
Protein sluggish-A
Gene namesi
Name:slgA
Synonyms:slg
ORF Names:CG1417
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome X

Organism-specific databases

FlyBaseiFBgn0003423. slgA.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Disruption phenotypei

Flies exhibit reduced proline oxidase activity which produces sluggish behavior.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 30MitochondrionSequence analysisAdd BLAST30
ChainiPRO_000002580331 – 681Proline dehydrogenase 1, mitochondrialAdd BLAST651

Proteomic databases

PaxDbiQ04499.
PRIDEiQ04499.

Expressioni

Tissue specificityi

Most abundant in developing nervous system.1 Publication

Developmental stagei

Expressed in developing embryo as well as in adult.1 Publication

Gene expression databases

BgeeiFBgn0003423.
ExpressionAtlasiQ04499. differential.
GenevisibleiQ04499. DM.

Interactioni

Protein-protein interaction databases

BioGridi59392. 19 interactors.
IntActiQ04499. 21 interactors.
STRINGi7227.FBpp0076903.

Structurei

3D structure databases

ProteinModelPortaliQ04499.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the proline oxidase family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG0186. Eukaryota.
COG0506. LUCA.
GeneTreeiENSGT00390000006265.
InParanoidiQ04499.
KOiK00318.
OMAiYLNEASC.
OrthoDBiEOG091G05G3.
PhylomeDBiQ04499.

Family and domain databases

Gene3Di3.20.20.220. 1 hit.
InterProiView protein in InterPro
IPR029041. FAD-linked_oxidoreductase-like.
IPR002872. Proline_DH_dom.
IPR015659. Proline_oxidase.
PANTHERiPTHR13914. PTHR13914. 1 hit.
PfamiView protein in Pfam
PF01619. Pro_dh. 1 hit.
SUPFAMiSSF51730. SSF51730. 3 hits.

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform D (identifier: Q04499-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALLRSLSAQ RTAISLVYGR NSSKSSNSVA VAACRSFHQR GSGSTSIAGE
60 70 80 90 100
GAASESTRGV NGARFLHSGD RPLQASTLVQ PEVVSSETVK RSMKQESSQE
110 120 130 140 150
KNPSPAGSPQ RDPLDVSFND PIAAFKSKTT GELIRAYLVY MICSSEKLVE
160 170 180 190 200
HNMTLMKLAR NLLGQKLFVL LMKSSFYGHF VAGENRHTIV PALERLRSFG
210 220 230 240 250
VKPILDYSVE EDITQEEAEK REVESSVSSA GDKKEEGSMP QYHVDKSFAD
260 270 280 290 300
RRYKVSSART YFYLNEATCE RNMEIFIKCL EAVSDDDRKA PRAVATGATF
310 320 330 340 350
GTGITAIKLT ALGRPQLLLQ LSEVIMRTRK YMEDMVGGQG NVLTHHKTIK
360 370 380 390 400
DLEKYYATLG DNKDVKEFLN NVTSDKEGIL HLFPWSGIVD EDSQLSDTFR
410 420 430 440 450
VPDPQTGQMR RLISQIPPKE EEMFRNMIRR LNTIVKAAAD LDVRIMVDAE
460 470 480 490 500
QTYFQPAISR ITLEMMRKYN KDKAIVFNTY QCYLRETFRE VNTDLEQAKR
510 520 530 540 550
QNFYFGAKLV RGAYMDQERD RAKSLGYPDP VNPTFEATTD MYHRTLSECL
560 570 580 590 600
RRIKLMKDCD DDARKIGIMV ASHNEDTVRF AIQQMKEIGI SPEDKVICFG
610 620 630 640 650
QLLGMCDYIT FPLGQAGYSA YKYIPYGPVE EVLPYLSRRA QENKGVLKKI
660 670 680
KKEKRLLLSE IRRRLMRGQL FYKPKGNYVP I
Note: No experimental confirmation available.
Length:681
Mass (Da):77,153
Last modified:August 30, 2005 - v2
Checksum:i2AB69ABB67D83FF8
GO
Isoform A (identifier: Q04499-2) [UniParc]FASTAAdd to basket
Also known as: F

The sequence of this isoform differs from the canonical sequence as follows:
     158-192: LARNLLGQKLFVLLMKSSFYGHFVAGENRHTIVPA → WSKNVLGQRLFTLLMKATFYGHFVAGEDQIKIIPT
     285-296: Missing.

Show »
Length:669
Mass (Da):75,952
Checksum:i89C68093DF0D82EE
GO
Isoform B (identifier: Q04499-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     285-296: Missing.

Note: No experimental confirmation available.
Show »
Length:669
Mass (Da):75,857
Checksum:i976800739C0839CC
GO
Isoform C (identifier: Q04499-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-325: Missing.

Note: No experimental confirmation available.
Show »
Length:356
Mass (Da):41,558
Checksum:iF1A5FF82FD03142C
GO
Isoform E (identifier: Q04499-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     158-192: LARNLLGQKLFVLLMKSSFYGHFVAGENRHTIVPA → WSKNVLGQRLFTLLMKATFYGHFVAGEDQIKIIPT

Note: No experimental confirmation available.
Show »
Length:681
Mass (Da):77,248
Checksum:i783D5C065E1EC77A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti42S → N in AAA02748 (PubMed:8096642).Curated1
Sequence conflicti147K → N in AAA02748 (PubMed:8096642).Curated1
Sequence conflicti149V → F in AAC28410 (PubMed:9520435).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0154001 – 325Missing in isoform C. CuratedAdd BLAST325
Alternative sequenceiVSP_015401158 – 192LARNL…TIVPA → WSKNVLGQRLFTLLMKATFY GHFVAGEDQIKIIPT in isoform A and isoform E. 2 PublicationsAdd BLAST35
Alternative sequenceiVSP_015402285 – 296Missing in isoform A and isoform B. 2 PublicationsAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L07330 mRNA. Translation: AAA02748.1.
AF017777 Genomic DNA. Translation: AAC28410.1.
AE014298 Genomic DNA. Translation: AAF50814.2.
AE014298 Genomic DNA. Translation: AAF50819.2.
AE014298 Genomic DNA. Translation: AAF50820.2.
AE014298 Genomic DNA. Translation: AAF50821.1.
AE014298 Genomic DNA. Translation: AAF50822.3.
AY069407 mRNA. Translation: AAL39552.1.
PIRiA47302.
RefSeqiNP_001245791.1. NM_001258862.2. [Q04499-3]
NP_001245792.1. NM_001258863.2. [Q04499-2]
NP_001245793.1. NM_001258864.2. [Q04499-2]
NP_001245794.1. NM_001258865.2. [Q04499-2]
NP_001245795.1. NM_001258866.2. [Q04499-3]
NP_001245796.1. NM_001258867.2. [Q04499-5]
NP_523433.2. NM_078709.4. [Q04499-5]
NP_728422.1. NM_167751.3. [Q04499-2]
NP_728423.1. NM_167752.3. [Q04499-1]
NP_728424.1. NM_167753.3. [Q04499-3]
NP_728425.1. NM_167754.2. [Q04499-4]
NP_996526.1. NM_206803.3. [Q04499-2]
NP_996527.1. NM_206804.3. [Q04499-2]
NP_996528.1. NM_206805.3. [Q04499-2]
UniGeneiDm.6612.

Genome annotation databases

EnsemblMetazoaiFBtr0077203; FBpp0076902; FBgn0003423. [Q04499-2]
FBtr0077204; FBpp0076903; FBgn0003423. [Q04499-1]
FBtr0077205; FBpp0076904; FBgn0003423. [Q04499-5]
FBtr0077206; FBpp0076905; FBgn0003423. [Q04499-3]
FBtr0077207; FBpp0076906; FBgn0003423. [Q04499-4]
FBtr0077208; FBpp0089304; FBgn0003423. [Q04499-2]
FBtr0077209; FBpp0089305; FBgn0003423. [Q04499-2]
FBtr0077210; FBpp0089306; FBgn0003423. [Q04499-2]
FBtr0307524; FBpp0300179; FBgn0003423. [Q04499-3]
FBtr0307525; FBpp0300180; FBgn0003423. [Q04499-2]
FBtr0307526; FBpp0300181; FBgn0003423. [Q04499-2]
FBtr0307527; FBpp0300182; FBgn0003423. [Q04499-2]
FBtr0307528; FBpp0300183; FBgn0003423. [Q04499-3]
FBtr0307529; FBpp0300184; FBgn0003423. [Q04499-5]
GeneIDi33117.
KEGGidme:Dmel_CG1417.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPROD_DROME
AccessioniPrimary (citable) accession number: Q04499
Secondary accession number(s): O61349
, Q8IQ45, Q8IQ46, Q8T0C7, Q9VRH7, Q9VRH8, Q9VRH9, Q9VRI2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: August 30, 2005
Last modified: September 27, 2017
This is version 136 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families