Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-activated potassium channel slowpoke

Gene

slo

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Potassium channel activated by both membrane depolarization or increase in cytosolic Ca2+ that mediates export of K+. Its activation dampens the excitatory events that elevate the cytosolic Ca2+ concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Kinetics are determined by alternative splicing, phosphorylation status and its combination interaction with Slob and 14-3-3-zeta. While the interaction with Slob1 alone increases its activity, its interaction with both Slob1 and 14-3-3-zeta decreases its activity.2 Publications

GO - Molecular functioni

GO - Biological processi

  • circadian behavior Source: FlyBase
  • circadian rhythm Source: FlyBase
  • locomotion involved in locomotory behavior Source: FlyBase
  • male courtship behavior, veined wing generated song production Source: FlyBase
  • negative regulation of neuromuscular synaptic transmission Source: FlyBase
  • potassium ion transport Source: UniProtKB
  • regulation of synaptic growth at neuromuscular junction Source: FlyBase
  • response to drug Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Calcium, Potassium

Enzyme and pathway databases

ReactomeiR-DME-1300642. Sperm Motility And Taxes.

Protein family/group databases

TCDBi1.A.1.3.1. the voltage-gated ion channel (vic) superfamily.

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-activated potassium channel slowpoke
Short name:
dSlo
Alternative name(s):
BK channel
Maxi K channel
Short name:
MaxiK
Gene namesi
Name:slo
ORF Names:CG10693
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 3R

Organism-specific databases

FlyBaseiFBgn0003429. slo.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 48ExtracellularSequence analysisAdd BLAST48
Transmembranei49 – 69Helical; Name=Segment S0Sequence analysisAdd BLAST21
Topological domaini70 – 127CytoplasmicSequence analysisAdd BLAST58
Transmembranei128 – 149Helical; Name=Segment S1Sequence analysisAdd BLAST22
Topological domaini150 – 164ExtracellularSequence analysisAdd BLAST15
Transmembranei165 – 185Helical; Name=Segment S2Sequence analysisAdd BLAST21
Topological domaini186 – 189CytoplasmicSequence analysis4
Transmembranei190 – 210Helical; Name=Segment S3Sequence analysisAdd BLAST21
Topological domaini211 – 214ExtracellularSequence analysis4
Transmembranei215 – 235Helical; Voltage-sensor; Name=Segment S4Sequence analysisAdd BLAST21
Topological domaini236 – 250CytoplasmicSequence analysisAdd BLAST15
Transmembranei251 – 271Helical; Name=Segment S5Sequence analysisAdd BLAST21
Topological domaini272 – 284ExtracellularSequence analysisAdd BLAST13
Intramembranei285 – 307Pore-forming; Name=P regionSequence analysisAdd BLAST23
Topological domaini308 – 316ExtracellularSequence analysis9
Transmembranei317 – 337Helical; Name=Segment S6Sequence analysisAdd BLAST21
Topological domaini338 – 1200CytoplasmicSequence analysisAdd BLAST863

GO - Cellular componenti

  • membrane Source: FlyBase
  • neuronal cell body Source: FlyBase
  • neuron projection Source: FlyBase
  • plasma membrane Source: FlyBase
  • voltage-gated potassium channel complex Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi552Y → F: Affects the interaction with SRC. 1 Publication1
Mutagenesisi978S → A: Does not affect activation of channel. 1 Publication1
Mutagenesisi1002 – 1006DDDDD → NNNNN: Alters calcium binding. 1 Publication5
Mutagenesisi1012Y → F: Affects the interaction with SRC. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000541411 – 1200Calcium-activated potassium channel slowpokeAdd BLAST1200

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei978Phosphoserine1 Publication1

Post-translational modificationi

Phosphorylated. Phosphorylation may be mediated by both PKA and SRC kinases, which activate the channel activity. Phosphorylation by PKA is however unclear. Indeed, although modulation of channel activity requires Pka-C1, it does not interacts with the whole PKA holoenzyme. Moreover, modulation of activity does not depend upon phosphorylation of Ser-978.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRIDEiQ03720.

PTM databases

iPTMnetiQ03720.

Expressioni

Tissue specificityi

Expressed in muscle cells, neurons of the CNS and PNS, mushroom bodies, a limited number of cells in embryonic and larval midgut and in epithelial-derived tracheal cells. During pupariation and embryogenesis, it is expressed in muscles many hours prior to the appearance of functional channels.2 Publications

Gene expression databases

BgeeiFBgn0003429.
ExpressionAtlasiQ03720. baseline.
GenevisibleiQ03720. DM.

Interactioni

Subunit structurei

Homotetramer; which constitutes the calcium-activated potassium channel (By similarity). Interacts with Slip1. Interacts with Slob, and, indirectly with 14-3-3-zeta via its interaction with Slob. Interacts with Pka-C1 and Src kinases, which can bind simultaneously to it.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Pka-C1P123705EBI-426805,EBI-82224
Slip1Q8MR315EBI-426805,EBI-123875
SlobQ8IPH9-12EBI-426805,EBI-424896
Src64BP005283EBI-426805,EBI-87092

Protein-protein interaction databases

BioGridi67865. 4 interactors.
IntActiQ03720. 9 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ03720.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini364 – 507RCK N-terminalAdd BLAST144

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni505 – 525Segment S7Add BLAST21
Regioni563 – 583Segment S8Add BLAST21
Regioni828 – 848Segment S9Add BLAST21
Regioni1017 – 1037Segment S10Add BLAST21

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi301 – 304Selectivity for potassium4
Motifi988 – 1010Calcium bowlAdd BLAST23

Domaini

The S4 segment, which is characterized by a series of positively charged amino acids at every third position, is part of the voltage-sensor.By similarity
The pore-forming domain (also referred as P region) is imbedded into the membrane, and forms the selectivity filter of the pore. It contains the signature sequence of potassium channels that displays selectivity to potassium (By similarity).By similarity
The RCK N-terminal domain mediates the homotetramerization, thereby promoting the assembly of monomers into functional potassium channel. It includes binding sites for Ca2+ and Mg2+ (By similarity).By similarity
The calcium bowl constitutes one of the Ca2+ sensors and probably acts as a Ca2+-binding site.1 Publication

Sequence similaritiesi

Contains 1 RCK N-terminal domain.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00530000063026.
InParanoidiQ03720.
KOiK04936.
OMAiVICELCY.
OrthoDBiEOG091G148D.
PhylomeDBiQ03720.

Family and domain databases

Gene3Di3.40.50.720. 2 hits.
InterProiIPR024939. Ca-act_K_channel_Slo.
IPR005821. Ion_trans_dom.
IPR003929. K_chnl_Ca-activ_BK_asu.
IPR016040. NAD(P)-bd_dom.
IPR028325. VG_K_chnl.
[Graphical view]
PANTHERiPTHR10027:SF10. PTHR10027:SF10. 3 hits.
PfamiPF03493. BK_channel_a. 1 hit.
PF00520. Ion_trans. 1 hit.
[Graphical view]
PRINTSiPR01449. BKCHANNELA.
PR00169. KCHANNEL.
SUPFAMiSSF51735. SSF51735. 1 hit.

Sequences (20)i

Sequence statusi: Complete.

This entry describes 20 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform N (identifier: Q03720-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASGLIDTNF SSTLANGMSG CDQSTVESLA DDPTDSPFDA DDCLKVRKYW
60 70 80 90 100
CFLLSSIFTF LAGLLVVLLW RAFAFVCCRK EPDLGPNDPK QKEQKASRNK
110 120 130 140 150
QEFEGTFMTE AKDWAGELIS GQTTTGRILV VLVFILSIAS LIIYFVDASS
160 170 180 190 200
EEVERCQKWS NNITQQIDLA FNIFFMVYFF IRFIAASDKL WFMLEMYSFV
210 220 230 240 250
DYFTIPPSFV SIYLDRTWIG LRFLRALRLM TVPDILQYLN VLKTSSSIRL
260 270 280 290 300
AQLVSIFISV WLTAAGIIHL LENSGDPLDF NNAHRLSYWT CVYFLIVTMS
310 320 330 340 350
TVGYGDVYCE TVLGRTFLVF FLLVGLAMFA SSIPEIIELV GSGNKYGGEL
360 370 380 390 400
KREHGKRHIV VCGHITYESV SHFLKDFLHE DREDVDVEVV FLHRKPPDLE
410 420 430 440 450
LEGLFKRHFT TVEFFQGTIM NPIDLQRVKV HEADACLVLA NKYCQDPDAE
460 470 480 490 500
DAANIMRVIS IKNYSDDIRV IIQLMQYHNK AYLLNIPSWD WKQGDDVICL
510 520 530 540 550
AELKLGFIAQ SCLAPGFSTM MANLFAMRSF KTSPDMQSWT NDYLRGTGME
560 570 580 590 600
MYTETLSPTF IGIPFAQATE LCFSKLKLLL LAIEIKGAEE GADSKISINP
610 620 630 640 650
RGAKIQANTQ GFFIAQSADE VKRAWFYCKA CHEDIKDETL IKKCKCKNLT
660 670 680 690 700
VQPRSKFDDL DEHHPAPTFT PPELPKRVHV RGSVSGDITR DREDTNLLNR
710 720 730 740 750
NVRRPNGTGN GTGGMHHMNN TAAAAAAAAA AGKQVNKVKP TVNVSRQVEG
760 770 780 790 800
QVISPSQYNR PTSRSSGTGT QNQNGGVSLP AGIADDQSKD FDFEKTEMKY
810 820 830 840 850
DSTGMFHWSP AKSLEDCILD RNQAAMTVLN GHVVVCLFAD PDSPLIGLRN
860 870 880 890 900
LVMPLRASNF HYHELKHVVI VGSVDYIRRE WKMLQNLPKI SVLNGSPLSR
910 920 930 940 950
ADLRAVNVNL CDMCCILSAK VPSNDDPTLA DKEAILASLN IKAMTFDDTI
960 970 980 990 1000
GVLSQRGPEF DNLSATAGSP IVLQRRGSVY GANVPMITEL VNDSNVQFLD
1010 1020 1030 1040 1050
QDDDDDPDTE LYLTQPFACG TAFAVSVLDS LMSTTYFNQN ALTLIRSLIT
1060 1070 1080 1090 1100
GGATPELELI LAEGAGLRGG YSTVESLSNR DRCRVGQISL YDGPLAQFGE
1110 1120 1130 1140 1150
CGKYGDLFVA ALKSYGMLCI GLYRFRDTSS SCDASSKRYV ITNPPDDFSL
1160 1170 1180 1190 1200
LPTDQVFVLM QFDPGLEYKP PAVRAPAGGR GTNTQGSGVG GGGSNKDDNS
Length:1,200
Mass (Da):133,102
Last modified:September 19, 2006 - v3
Checksum:i306A12234C63AD0D
GO
Isoform 2 (identifier: Q03720-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     650-661: TVQPRSKFDDLD → ATFRKGVRAVQMVGRAKDDEYSLSN
     761-761: P → PPENDANPYAGYQLAYEVKKLMP

Show »
Length:1,235
Mass (Da):136,974
Checksum:i66119577C4671293
GO
Isoform 3 (identifier: Q03720-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     761-761: P → PPENDANPYAGYQLAYEVKKLMP

Show »
Length:1,222
Mass (Da):135,596
Checksum:i2524894C531A23E2
GO
Isoform 5 (identifier: Q03720-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-426: PPDLELEGLFKRHFTTVEFFQGTIMNPIDLQ → EPDLELEGLLKRHYTTVAFFQGTMMNAVDLE
     536-569: MQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQAT → TQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQAS
     650-661: TVQPRSKFDDLD → ATFRKGVRAVQMVGRAKDDEYSLSN
     761-761: P → PPENDANPYAGYQLAYEVKKLMP

Show »
Length:1,235
Mass (Da):136,842
Checksum:i78F5124596264C04
GO
Isoform 6 (identifier: Q03720-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: Missing.
     328-356: MFASSIPEIIELVGSGNKYGGELKREHGK → IFASCIPEIIDLIGTRAKYGGTLKNEKGR
     396-426: PPDLELEGLFKRHFTTVEFFQGTIMNPIDLQ → EPDLELEGLLKRHYTTVAFFQGTMMNAVDLE
     650-661: TVQPRSKFDDLD → ATFRKGVRAVQMVGRAN
     761-761: P → PPENDANPYAGYQLAYEVKKLMP

Show »
Length:1,210
Mass (Da):134,308
Checksum:i57CAD7C7319040E1
GO
Isoform A (identifier: Q03720-5) [UniParc]FASTAAdd to basket
Also known as: G

The sequence of this isoform differs from the canonical sequence as follows:
     661-685: Missing.

Show »
Length:1,175
Mass (Da):130,329
Checksum:i5F3D3DF608925F11
GO
Isoform B (identifier: Q03720-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: Missing.

Show »
Length:1,183
Mass (Da):131,421
Checksum:i8E015F553A173BD3
GO
Isoform C (identifier: Q03720-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: Missing.
     536-569: MQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQAT → TQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQAS

Note: No experimental confirmation available.
Show »
Length:1,183
Mass (Da):131,354
Checksum:iC7CF028A72DEB2EC
GO
Isoform D (identifier: Q03720-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-355: MFASSIPEIIELVGSGNKYGGELKREHG → VFASWIPEITELAAQRSKYGGTYSKDPR
     661-685: Missing.

Show »
Length:1,175
Mass (Da):130,481
Checksum:iCA329D9F19769C07
GO
Isoform E (identifier: Q03720-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-356: MFASSIPEIIELVGSGNKYGGELKREHGK → IFASCIPEIIDLIGTRAKYGGTLKNEKGR
     661-685: Missing.

Show »
Length:1,175
Mass (Da):130,346
Checksum:i303BFBDD056C3F5E
GO
Isoform F (identifier: Q03720-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-426: PPDLELEGLFKRHFTTVEFFQGTIMNPIDLQ → EPDLELEGLLKRHYTTVAFFQGTMMNAVDLE
     661-685: Missing.

Note: No experimental confirmation available.
Show »
Length:1,175
Mass (Da):130,264
Checksum:i24E95ABD6025A0CE
GO
Isoform H (identifier: Q03720-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     536-569: MQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQAT → TQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQAS
     661-685: Missing.

Show »
Length:1,175
Mass (Da):130,262
Checksum:i7EAADDEF4520F7DC
GO
Isoform I (identifier: Q03720-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     650-661: TVQPRSKFDDLD → ATFRKGVRAVQMVGRAKDDEYSLSN

Show »
Length:1,213
Mass (Da):134,481
Checksum:iE80AAC5510D907E8
GO
Isoform J (identifier: Q03720-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     650-686: TVQPRSKFDDLDEHHPAPTFTPPELPKRVHVRGSVSG → ATFRKGVRAVQMVGRAS

Show »
Length:1,180
Mass (Da):130,801
Checksum:iE4ED321A7EFE2662
GO
Isoform K (identifier: Q03720-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     661-697: DEHHPAPTFTPPELPKRVHVRGSVSGDITRDREDTNL → V

Note: No experimental confirmation available.
Show »
Length:1,164
Mass (Da):129,042
Checksum:i178E53434D1DE087
GO
Isoform L (identifier: Q03720-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     649-685: LTVQPRSKFDDLDEHHPAPTFTPPELPKRVHVRGSVS → YVGMIMMQTGMVNQGITSVMNTME

Show »
Length:1,187
Mass (Da):131,577
Checksum:i9CAEDDAB27913D0A
GO
Isoform M (identifier: Q03720-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     661-685: Missing.
     761-761: P → PPENDANPYAGYQLAYEVKKLMP

Note: No experimental confirmation available.
Show »
Length:1,197
Mass (Da):132,823
Checksum:iAE414DF14B75B7F2
GO
Isoform O (identifier: Q03720-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     536-569: MQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQAT → TQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQAS
     661-697: DEHHPAPTFTPPELPKRVHVRGSVSGDITRDREDTNL → V

Note: No experimental confirmation available.
Show »
Length:1,164
Mass (Da):128,974
Checksum:iBD5D193C28635C0A
GO
Isoform P (identifier: Q03720-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-356: MFASSIPEIIELVGSGNKYGGELKREHGK → IFASCIPEIIDLIGTRAKYGGTLKNEKGR
     536-569: MQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQAT → TQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQAS
     661-697: DEHHPAPTFTPPELPKRVHVRGSVSGDITRDREDTNL → V

Show »
Length:1,164
Mass (Da):128,991
Checksum:iD9C70FAE1B9F54D1
GO
Isoform Q (identifier: Q03720-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-356: MFASSIPEIIELVGSGNKYGGELKREHGK → IFASCIPEIIDLIGTRAKYGGTLKNEKGR
     536-569: MQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQAT → TQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQAS
     661-685: Missing.

Show »
Length:1,175
Mass (Da):130,279
Checksum:i11AC1BC448DE9793
GO

Sequence cautioni

The sequence AAA28902 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAO45232 differs from that shown. Reason: Frameshift at position 192.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti81E → R in AAC47020 (PubMed:8774450).Curated1
Sequence conflicti81E → R in AAC47021 (PubMed:8774450).Curated1
Sequence conflicti281N → D in AAA28902 (PubMed:1857984).Curated1
Sequence conflicti281N → D in AAA28651 (PubMed:1497890).Curated1
Sequence conflicti281N → D in AAO45232 (PubMed:12537569).Curated1
Sequence conflicti994S → G in AAA28902 (PubMed:1857984).Curated1
Sequence conflicti994S → G in AAA28651 (PubMed:1497890).Curated1
Sequence conflicti994S → G in AAO45232 (PubMed:12537569).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0099991 – 17Missing in isoform 6, isoform B and isoform C. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_010000328 – 356MFASS…REHGK → IFASCIPEIIDLIGTRAKYG GTLKNEKGR in isoform 6, isoform E, isoform P and isoform Q. 2 PublicationsAdd BLAST29
Alternative sequenceiVSP_020625328 – 355MFASS…KREHG → VFASWIPEITELAAQRSKYG GTYSKDPR in isoform D. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_010001396 – 426PPDLE…PIDLQ → EPDLELEGLLKRHYTTVAFF QGTMMNAVDLE in isoform 5, isoform 6 and isoform F. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_010002536 – 569MQSWT…FAQAT → TQAWQNDYLQGTGCEMYTET LSPSFTGMTFPQAS in isoform 5, isoform C, isoform H, isoform O, isoform P and isoform Q. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_020626649 – 685LTVQP…RGSVS → YVGMIMMQTGMVNQGITSVM NTME in isoform L. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_020627650 – 686TVQPR…GSVSG → ATFRKGVRAVQMVGRAS in isoform J. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_050267650 – 661TVQPR…FDDLD → ATFRKGVRAVQMVGRAKDDE YSLSN in isoform 2, isoform 5 and isoform I. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_010003650 – 661TVQPR…FDDLD → ATFRKGVRAVQMVGRAN in isoform 6. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_020628661 – 697DEHHP…EDTNL → V in isoform K, isoform O and isoform P. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_010004661 – 685Missing in isoform A, isoform D, isoform E, isoform F, isoform H, isoform M and isoform Q. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_050268761P → PPENDANPYAGYQLAYEVKK LMP in isoform 2, isoform 3, isoform 5, isoform 6 and isoform M. 3 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M69053 mRNA. Translation: AAA28902.1. Different initiation.
M96840 mRNA. Translation: AAA28651.1.
AE014297 Genomic DNA. Translation: AAF56324.1.
AE014297 Genomic DNA. Translation: AAN14013.1.
AE014297 Genomic DNA. Translation: AAS65211.1.
AE014297 Genomic DNA. Translation: AAX52977.1.
AE014297 Genomic DNA. Translation: AAX52978.1.
AE014297 Genomic DNA. Translation: AAX52979.1.
AE014297 Genomic DNA. Translation: AAX52980.2.
AE014297 Genomic DNA. Translation: AAX52981.1.
AE014297 Genomic DNA. Translation: AAX52982.1.
AE014297 Genomic DNA. Translation: AAX52983.1.
AE014297 Genomic DNA. Translation: AAX52984.1.
AE014297 Genomic DNA. Translation: AAX52985.1.
AE014297 Genomic DNA. Translation: AAX52986.1.
AE014297 Genomic DNA. Translation: AAX52987.1.
AE014297 Genomic DNA. Translation: AAX52988.1.
AE014297 Genomic DNA. Translation: AAX52989.1.
AE014297 Genomic DNA. Translation: AAX52990.1.
BT004876 mRNA. Translation: AAO45232.1. Frameshift.
U40315 Genomic DNA. Translation: AAC47020.1.
U40315 Genomic DNA. Translation: AAC47021.1.
PIRiA39800.
C39800.
JH0697.
PS0438.
PS0439.
PS0440.
PS0441.
PS0446.
RefSeqiNP_001014651.1. NM_001014651.3. [Q03720-20]
NP_001014652.1. NM_001014652.3. [Q03720-19]
NP_001014653.1. NM_001014653.3. [Q03720-18]
NP_001014654.1. NM_001014654.3. [Q03720-1]
NP_001014655.1. NM_001014655.3. [Q03720-17]
NP_001014656.1. NM_001014656.3. [Q03720-16]
NP_001014657.1. NM_001014657.3. [Q03720-15]
NP_001014658.1. NM_001014658.3. [Q03720-14]
NP_001014659.1. NM_001014659.3. [Q03720-13]
NP_001014660.1. NM_001014660.3. [Q03720-12]
NP_001014661.2. NM_001014661.4. [Q03720-3]
NP_001014662.1. NM_001014662.3. [Q03720-11]
NP_001014663.1. NM_001014663.3. [Q03720-10]
NP_001014664.1. NM_001014664.3. [Q03720-9]
NP_524486.2. NM_079762.4. [Q03720-5]
NP_733029.1. NM_170164.4. [Q03720-7]
NP_996289.1. NM_206566.4. [Q03720-8]
UniGeneiDm.19520.

Genome annotation databases

EnsemblMetazoaiFBtr0100635; FBpp0100095; FBgn0003429. [Q03720-1]
GeneIDi42940.
KEGGidme:Dmel_CG10693.
UCSCiCG10693-RA. d. melanogaster.
CG10693-RG. d. melanogaster.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M69053 mRNA. Translation: AAA28902.1. Different initiation.
M96840 mRNA. Translation: AAA28651.1.
AE014297 Genomic DNA. Translation: AAF56324.1.
AE014297 Genomic DNA. Translation: AAN14013.1.
AE014297 Genomic DNA. Translation: AAS65211.1.
AE014297 Genomic DNA. Translation: AAX52977.1.
AE014297 Genomic DNA. Translation: AAX52978.1.
AE014297 Genomic DNA. Translation: AAX52979.1.
AE014297 Genomic DNA. Translation: AAX52980.2.
AE014297 Genomic DNA. Translation: AAX52981.1.
AE014297 Genomic DNA. Translation: AAX52982.1.
AE014297 Genomic DNA. Translation: AAX52983.1.
AE014297 Genomic DNA. Translation: AAX52984.1.
AE014297 Genomic DNA. Translation: AAX52985.1.
AE014297 Genomic DNA. Translation: AAX52986.1.
AE014297 Genomic DNA. Translation: AAX52987.1.
AE014297 Genomic DNA. Translation: AAX52988.1.
AE014297 Genomic DNA. Translation: AAX52989.1.
AE014297 Genomic DNA. Translation: AAX52990.1.
BT004876 mRNA. Translation: AAO45232.1. Frameshift.
U40315 Genomic DNA. Translation: AAC47020.1.
U40315 Genomic DNA. Translation: AAC47021.1.
PIRiA39800.
C39800.
JH0697.
PS0438.
PS0439.
PS0440.
PS0441.
PS0446.
RefSeqiNP_001014651.1. NM_001014651.3. [Q03720-20]
NP_001014652.1. NM_001014652.3. [Q03720-19]
NP_001014653.1. NM_001014653.3. [Q03720-18]
NP_001014654.1. NM_001014654.3. [Q03720-1]
NP_001014655.1. NM_001014655.3. [Q03720-17]
NP_001014656.1. NM_001014656.3. [Q03720-16]
NP_001014657.1. NM_001014657.3. [Q03720-15]
NP_001014658.1. NM_001014658.3. [Q03720-14]
NP_001014659.1. NM_001014659.3. [Q03720-13]
NP_001014660.1. NM_001014660.3. [Q03720-12]
NP_001014661.2. NM_001014661.4. [Q03720-3]
NP_001014662.1. NM_001014662.3. [Q03720-11]
NP_001014663.1. NM_001014663.3. [Q03720-10]
NP_001014664.1. NM_001014664.3. [Q03720-9]
NP_524486.2. NM_079762.4. [Q03720-5]
NP_733029.1. NM_170164.4. [Q03720-7]
NP_996289.1. NM_206566.4. [Q03720-8]
UniGeneiDm.19520.

3D structure databases

ProteinModelPortaliQ03720.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi67865. 4 interactors.
IntActiQ03720. 9 interactors.

Protein family/group databases

TCDBi1.A.1.3.1. the voltage-gated ion channel (vic) superfamily.

PTM databases

iPTMnetiQ03720.

Proteomic databases

PRIDEiQ03720.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0100635; FBpp0100095; FBgn0003429. [Q03720-1]
GeneIDi42940.
KEGGidme:Dmel_CG10693.
UCSCiCG10693-RA. d. melanogaster.
CG10693-RG. d. melanogaster.

Organism-specific databases

CTDi42940.
FlyBaseiFBgn0003429. slo.

Phylogenomic databases

GeneTreeiENSGT00530000063026.
InParanoidiQ03720.
KOiK04936.
OMAiVICELCY.
OrthoDBiEOG091G148D.
PhylomeDBiQ03720.

Enzyme and pathway databases

ReactomeiR-DME-1300642. Sperm Motility And Taxes.

Miscellaneous databases

ChiTaRSislo. fly.
GenomeRNAii42940.
PROiQ03720.

Gene expression databases

BgeeiFBgn0003429.
ExpressionAtlasiQ03720. baseline.
GenevisibleiQ03720. DM.

Family and domain databases

Gene3Di3.40.50.720. 2 hits.
InterProiIPR024939. Ca-act_K_channel_Slo.
IPR005821. Ion_trans_dom.
IPR003929. K_chnl_Ca-activ_BK_asu.
IPR016040. NAD(P)-bd_dom.
IPR028325. VG_K_chnl.
[Graphical view]
PANTHERiPTHR10027:SF10. PTHR10027:SF10. 3 hits.
PfamiPF03493. BK_channel_a. 1 hit.
PF00520. Ion_trans. 1 hit.
[Graphical view]
PRINTSiPR01449. BKCHANNELA.
PR00169. KCHANNEL.
SUPFAMiSSF51735. SSF51735. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSLO_DROME
AccessioniPrimary (citable) accession number: Q03720
Secondary accession number(s): A4V3D4
, Q24369, Q24384, Q24385, Q59DU0, Q59DU1, Q59DU2, Q59DU3, Q59DU4, Q59DU5, Q59DU6, Q59DU7, Q59DU8, Q59DU9, Q59DV0, Q59DV1, Q59DV2, Q7JP74, Q7KS13, Q86NK5, Q8IMV9, Q9TWA1, Q9VC51
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: September 19, 2006
Last modified: November 30, 2016
This is version 153 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.