Q03669 (AT2A2_CHICK) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 Short name=SERCA2 Short name=SR Ca(2+)-ATPase 2 EC=3.6.3.8 Alternative name(s): Calcium pump 2 Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform Endoplasmic reticulum class 1/2 Ca(2+) ATPase | ||
| Gene names |
| ||
| Organism | Gallus gallus (Chicken) | ||
| Taxonomic identifier | 9031 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Archosauria › Dinosauria › Saurischia › Theropoda › Coelurosauria › Aves › Neognathae › Galliformes › Phasianidae › Phasianinae › Gallus |
Protein attributes
| Sequence length | 1041 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Isoform SERCA2A is involved in the regulation of the contraction/relaxation cycle By similarity. |
| Catalytic activity | ATP + H2O + Ca2+[side 1] = ADP + phosphate + Ca2+[side 2]. |
| Enzyme regulation | Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN By similarity. |
| Subunit structure | Associated with phospholamban (PLN) By similarity. |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein. |
| Tissue specificity | Only isoform SERCA2A is detected in heart, while both isoforms are expressed in brain, with SERCA2B being the predominant form. |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification] |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform SERCA2B (identifier: Q03669-1) Also known as: ATP2A2B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SERCA2A (identifier: Q03669-2) Also known as: ATP2A2A; The sequence of this isoform differs from the canonical sequence as follows: 994-1041: GKDSVQPATKPCSLSACTEGVSWPFVFITLPLVIWLYSTDTNFSDMFW → AILE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1041 | 1041 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 | PRO_0000046201 | |||||
Regions | |||||||||
| Topological domain | 1 – 48 | 48 | Cytoplasmic By similarity | ||||||
| Transmembrane | 49 – 69 | 21 | Helical; Name=1; By similarity | ||||||
| Topological domain | 70 – 89 | 20 | Lumenal By similarity | ||||||
| Transmembrane | 90 – 110 | 21 | Helical; Name=2; By similarity | ||||||
| Topological domain | 111 – 253 | 143 | Cytoplasmic By similarity | ||||||
| Transmembrane | 254 – 273 | 20 | Helical; Name=3; By similarity | ||||||
| Topological domain | 274 – 295 | 22 | Lumenal By similarity | ||||||
| Transmembrane | 296 – 313 | 18 | Helical; Name=4; By similarity | ||||||
| Topological domain | 314 – 756 | 443 | Cytoplasmic By similarity | ||||||
| Transmembrane | 757 – 776 | 20 | Helical; Name=5; By similarity | ||||||
| Topological domain | 777 – 786 | 10 | Lumenal By similarity | ||||||
| Transmembrane | 787 – 807 | 21 | Helical; Name=6; By similarity | ||||||
| Topological domain | 808 – 827 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 828 – 850 | 23 | Helical; Name=7; By similarity | ||||||
| Topological domain | 851 – 896 | 46 | Lumenal By similarity | ||||||
| Transmembrane | 897 – 916 | 20 | Helical; Name=8; By similarity | ||||||
| Topological domain | 917 – 929 | 13 | Cytoplasmic By similarity | ||||||
| Transmembrane | 930 – 948 | 19 | Helical; Name=9; By similarity | ||||||
| Topological domain | 949 – 963 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 964 – 984 | 21 | Helical; Name=10; By similarity | ||||||
| Topological domain | 985 – 1041 | 57 | Cytoplasmic By similarity | ||||||
| Region | 370 – 400 | 31 | Interacts with phospholamban 1 By similarity | ||||||
| Region | 787 – 807 | 21 | Interacts with phospholamban 2 By similarity | ||||||
Sites | |||||||||
| Active site | 351 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 304 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 305 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 307 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 309 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 702 | 1 | Magnesium By similarity | ||||||
| Metal binding | 706 | 1 | Magnesium By similarity | ||||||
| Metal binding | 767 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 770 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 795 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 798 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 907 | 1 | Calcium 1 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 994 – 1041 | 48 | GKDSV…SDMFW → AILE in isoform SERCA2A. | VSP_000363 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Nucleotide sequences of avian cardiac and brain SR/ER Ca(2+)-ATPases and functional comparisons with fast twitch Ca(2+)-ATPase. Calcium affinities and inhibitor effects." Campbell A.M., Kessler P.D., Sagara Y., Inesi G., Fambrough D.M. J. Biol. Chem. 266:16050-16055(1991) [PubMed: 1831452] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA2A AND SERCA2B). Strain: White leghorn. Tissue: Brain and Heart. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M66385 mRNA. Translation: AAA49066.1. |
| IPI | IPI00603179. IPI00819293. |
| PIR | A40812. |
| UniGene | Gga.42608. |
3D structure databases | |
| ProteinModelPortal | Q03669. |
| SMR | Q03669. Positions 1-992. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q03669. |
Proteomic databases | |
| PRIDE | Q03669. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSGALT00000034610; ENSGALP00000033967; ENSGALG00000003835. ENSGALT00000039313; ENSGALP00000038523; ENSGALG00000003835. |
Phylogenomic databases | |
| eggNOG | veNOG07086. |
| GeneTree | ENSGT00560000076887. |
| HOGENOM | HBG456486. |
| HOVERGEN | HBG105648. |
| InParanoid | Q03669. |
| OMA | CTIFESP. |
| OrthoDB | EOG4SXNBQ. |
| PhylomeDB | Q03669. |
Family and domain databases | |
| InterPro | IPR023306. ATPase_cation_domN. IPR008250. ATPase_P-typ_ATPase-assoc-dom. IPR005782. ATPase_P-typ_Ca-transp. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR023300. ATPase_P-typ_cyto_domA. IPR023299. ATPase_P-typ_cyto_domN. IPR000695. ATPase_P-typ_H-transp. IPR001757. ATPase_P-typ_ion-transptr. IPR018303. ATPase_P-typ_P_site. IPR023298. ATPase_P-typ_TM_dom. IPR005834. Dehalogen-like_hydro. IPR023214. HAD-like_dom. [Graphical view] |
| Gene3D | G3DSA:2.70.150.10. ATPase_P-typ_cyto_domA. 2 hits. G3DSA:3.40.1110.10. ATPase_P-typ_cyto_domN. 1 hit. G3DSA:1.20.1110.10. ATPase_P-typ_TM_dom. 2 hits. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. PR00120. HATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| SUPFAM | SSF81660. ATPase_cation_domN. 1 hit. SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR01116. ATPase-IIA1_Ca. 1 hit. TIGR01494. ATPase_P-type. 2 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | AT2A2_CHICK | ||||||||
| Accession | Primary (citable) accession number: Q03669 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with