Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q03351

- NTRK3_RAT

UniProt

Q03351 - NTRK3_RAT

Protein

NT-3 growth factor receptor

Gene

Ntrk3

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 150 (01 Oct 2014)
      Sequence version 2 (01 Feb 1994)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for neurotrophin-3 (NTF3). This is a tyrosine-protein kinase receptor. Known substrates for the TRK receptors are SHC1, PI-3 kinase, and PLCG1. TrkC isoforms containing insertions within the kinase domain can autophosphorylate in response to NT-3, but cannot mediate downstream phenotypic responses.

    Catalytic activityi

    ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei516 – 5161Interaction with SHC1By similarity
    Binding sitei572 – 5721ATPPROSITE-ProRule annotation
    Active sitei679 – 6791Proton acceptorPROSITE-ProRule annotation
    Sitei859 – 8591Interaction with PLC-gamma-1By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi544 – 5529ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. ephrin receptor binding Source: BHF-UCL
    3. neurotrophin receptor activity Source: RGD
    4. transmembrane receptor protein tyrosine kinase activity Source: UniProtKB-EC

    GO - Biological processi

    1. activation of MAPK activity Source: Ensembl
    2. activation of protein kinase B activity Source: Ensembl
    3. activation of Ras GTPase activity Source: Ensembl
    4. cellular response to retinoic acid Source: RGD
    5. cochlea development Source: RGD
    6. mechanoreceptor differentiation Source: Ensembl
    7. modulation by virus of host transcription Source: RGD
    8. negative regulation of astrocyte differentiation Source: RGD
    9. negative regulation of cell death Source: RGD
    10. negative regulation of protein phosphorylation Source: Ensembl
    11. neuron fate specification Source: RGD
    12. neuron migration Source: RGD
    13. positive regulation of actin cytoskeleton reorganization Source: Ensembl
    14. positive regulation of axon extension involved in regeneration Source: Ensembl
    15. positive regulation of cell migration Source: Ensembl
    16. positive regulation of cell proliferation Source: Ensembl
    17. positive regulation of gene expression Source: Ensembl
    18. positive regulation of peptidyl-serine phosphorylation Source: Ensembl
    19. positive regulation of positive chemotaxis Source: Ensembl
    20. protein autophosphorylation Source: RGD
    21. response to axon injury Source: RGD
    22. response to corticosterone Source: RGD
    23. response to ethanol Source: RGD
    24. transmembrane receptor protein tyrosine kinase signaling pathway Source: Ensembl

    Keywords - Molecular functioni

    Developmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase

    Keywords - Biological processi

    Differentiation, Neurogenesis

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDAi2.7.10.1. 5301.
    ReactomeiREACT_219269. PLC-gamma1 signalling.

    Protein family/group databases

    MEROPSiI43.001.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    NT-3 growth factor receptor (EC:2.7.10.1)
    Alternative name(s):
    GP145-TrkC
    Short name:
    Trk-C
    Neurotrophic tyrosine kinase receptor type 3
    TrkC tyrosine kinase
    Gene namesi
    Name:Ntrk3
    Synonyms:Trkc
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Chromosome 1

    Organism-specific databases

    RGDi3214. Ntrk3.

    Subcellular locationi

    GO - Cellular componenti

    1. Golgi membrane Source: Reactome
    2. integral component of plasma membrane Source: InterPro
    3. membrane Source: RGD
    4. plasma membrane Source: RGD

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3131By similarityAdd
    BLAST
    Chaini32 – 864833NT-3 growth factor receptorPRO_0000016735Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi68 – 681N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi72 – 721N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi79 – 791N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi133 – 1331N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi163 – 1631N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi203 – 2031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi218 – 2181N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi232 – 2321N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi259 – 2591N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi267 – 2671N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi272 – 2721N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi294 – 2941N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi320 ↔ 362PROSITE-ProRule annotation
    Glycosylationi375 – 3751N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi388 – 3881N-linked (GlcNAc...)Sequence Analysis
    Modified residuei516 – 5161Phosphotyrosine; by autocatalysisBy similarity
    Modified residuei705 – 7051Phosphotyrosine; by autocatalysisBy similarity
    Modified residuei709 – 7091Phosphotyrosine; by autocatalysisBy similarity
    Modified residuei710 – 7101Phosphotyrosine; by autocatalysisBy similarity
    Modified residuei859 – 8591Phosphotyrosine; by autocatalysisBy similarity

    Post-translational modificationi

    Ligand-mediated auto-phosphorylation.

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ03351.
    PRIDEiQ03351.

    PTM databases

    PhosphoSiteiQ03351.

    Expressioni

    Tissue specificityi

    Widely expressed, mainly in the nervous tissue.

    Gene expression databases

    GenevestigatoriQ03351.

    Interactioni

    Subunit structurei

    Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. Binds SH2B2. Interacts with SQSTM1 and KIDINS220.3 Publications

    Protein-protein interaction databases

    DIPiDIP-5718N.
    MINTiMINT-1208236.
    STRINGi10116.ENSRNOP00000046935.

    Structurei

    3D structure databases

    ProteinModelPortaliQ03351.
    SMRiQ03351. Positions 300-401.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini32 – 429398ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini454 – 864411CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei430 – 45324HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati104 – 12522LRR 1Add
    BLAST
    Repeati128 – 14922LRR 2Add
    BLAST
    Domaini160 – 20950LRRCTAdd
    BLAST
    Domaini210 – 30091Ig-like C2-type 1Add
    BLAST
    Domaini309 – 38274Ig-like C2-type 2Add
    BLAST
    Domaini538 – 853316Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation
    Contains 2 LRR (leucine-rich) repeats.Curated
    Contains 1 LRRCT domain.Curated
    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0515.
    GeneTreeiENSGT00730000110657.
    HOGENOMiHOG000264255.
    HOVERGENiHBG056735.
    InParanoidiQ03351.
    KOiK05101.
    OMAiNFVSIYE.
    OrthoDBiEOG7GTT32.
    PhylomeDBiQ03351.
    TreeFamiTF106465.

    Family and domain databases

    Gene3Di2.60.40.10. 2 hits.
    InterProiIPR000483. Cys-rich_flank_reg_C.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR011009. Kinase-like_dom.
    IPR001611. Leu-rich_rpt.
    IPR000372. LRR-contain_N.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR020446. Tyr_kin_neurotrophic_rcpt_3.
    IPR008266. Tyr_kinase_AS.
    IPR020635. Tyr_kinase_cat_dom.
    IPR020777. Tyr_kinase_NGF_rcpt.
    IPR002011. Tyr_kinase_rcpt_2_CS.
    [Graphical view]
    PfamiPF07679. I-set. 2 hits.
    PF13855. LRR_8. 1 hit.
    PF01462. LRRNT. 1 hit.
    PF07714. Pkinase_Tyr. 2 hits.
    [Graphical view]
    PRINTSiPR01939. NTKRECEPTOR.
    PR01942. NTKRECEPTOR3.
    PR00109. TYRKINASE.
    SMARTiSM00409. IG. 1 hit.
    SM00082. LRRCT. 1 hit.
    SM00013. LRRNT. 1 hit.
    SM00219. TyrKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 2 hits.
    PROSITEiPS50835. IG_LIKE. 1 hit.
    PS51450. LRR. 1 hit.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00109. PROTEIN_KINASE_TYR. 1 hit.
    PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform KI39 (identifier: Q03351-1) [UniParc]FASTAAdd to Basket

    Also known as: TRKC(KI39), TRKC-39

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDVSLCPAKC SFWRIFLLGS VWLDYVGSVL ACPANCVCSK TEINCRRPDD    50
    GNLFPLLEGQ DSGNSNGNAS INITDISRNI TSIHIENWRG LHTLNAVDME 100
    LYTGLQKLTI KNSGLRNIQP RAFAKNPHLR YINLSSNRLT TLSWQLFQTL 150
    SLRELRLEQN FFNCSCDIRW MQLWQEQGEA RLDSQSLYCI SADGSQLPLF 200
    RMNISQCDLP EISVSHVNLT VREGDNAVIT CNGSGSPLPD VDWIVTGLQS 250
    INTHQTNLNW TNVHAINLTL VNVTSEDNGF TLTCIAENVV GMSNASVALT 300
    VYYPPRVVSL VEPEVRLEHC IEFVVRGNPT PTLHWLYNGQ PLRESKIIHM 350
    DYYQEGEVSE GCLLFNKPTH YNNGNYTLIA KNALGTANQT INGHFLKEPF 400
    PESTDFFDFE SDASPTPPIT VTHKPEEDTF GVSIAVGLAA FACVLLVVLF 450
    IMINKYGRRS KFGMKGPVAV ISGEEDSASP LHHINHGITT PSSLDAGPDT 500
    VVIGMTRIPV IENPQYFRQG HNCHKPDTYV QHIKRRDIVL KRELGEGAFG 550
    KVFLAECYNL SPTKDKMLVA VKALKDPTLA ARKDFQREAE LLTNLQHEHI 600
    VKFYGVCGDG DPLIMVFEYM KHGDLNKFLR AHGPDAMILV DGQPRQAKGE 650
    LGLSQMLHIA SQIASGMVYL ASQHFVHRDL ATRNCLVGAN LLVKIGDFGM 700
    SRDVYSTDYY REGPYQKGPF SVSWQQQRLA ASAASTLFNP SGNDFCIWCE 750
    VGGHTMLPIR WMPPESIMYR KFTTESDVWS FGVILWEIFT YGKQPWFQLS 800
    NTEVIECITQ GRVLERPRVC PKEVYDVMLG CWQREPQQRL NIKEIYKILH 850
    ALGKATPIYL DILG 864
    Length:864
    Mass (Da):97,064
    Last modified:February 1, 1994 - v2
    Checksum:iA202E993E208F636
    GO
    Isoform TRKC (identifier: Q03351-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         712-736: Missing.
         737-750: Missing.

    Show »
    Length:825
    Mass (Da):92,760
    Checksum:i4DE08AB546CC5BD6
    GO
    Isoform KI14 (identifier: Q03351-3) [UniParc]FASTAAdd to Basket

    Also known as: TRKC(KI14), TRKC-14

    The sequence of this isoform differs from the canonical sequence as follows:
         712-736: Missing.

    Show »
    Length:839
    Mass (Da):94,387
    Checksum:i78F3574FD80D983A
    GO
    Isoform KI25 (identifier: Q03351-4) [UniParc]FASTAAdd to Basket

    Also known as: TRKC-25

    The sequence of this isoform differs from the canonical sequence as follows:
         737-750: Missing.

    Show »
    Length:850
    Mass (Da):95,437
    Checksum:iC4CDDD82FF313324
    GO
    Isoform IC158 (identifier: Q03351-5) [UniParc]FASTAAdd to Basket

    Also known as: TRKC(IC158), TRKCTK-

    The sequence of this isoform differs from the canonical sequence as follows:
         529-612: YVQHIKRRDI...FYGVCGDGDP → WVFSNIDNHG...VYFSKGRHGF
         613-864: Missing.

    Show »
    Length:612
    Mass (Da):68,387
    Checksum:i376F0F449792CE46
    GO
    Isoform IC143 (identifier: Q03351-6) [UniParc]FASTAAdd to Basket

    Also known as: TRKC(IC143)

    The sequence of this isoform differs from the canonical sequence as follows:
         529-597: YVQHIKRRDI...EAELLTNLQH → WVFSNIDNHG...LPLPVLILKT
         598-864: Missing.

    Show »
    Length:597
    Mass (Da):66,618
    Checksum:i202BBA3831315D3D
    GO
    Isoform IC113 (identifier: Q03351-7) [UniParc]FASTAAdd to Basket

    Also known as: TRKC(IC113)

    The sequence of this isoform differs from the canonical sequence as follows:
         529-567: YVQHIKRRDI...YNLSPTKDKM → CFREIMLNPI...VYFSKGRHGF
         568-864: Missing.

    Show »
    Length:567
    Mass (Da):63,172
    Checksum:i87C245CD9147639B
    GO
    Isoform IC108 (identifier: Q03351-8) [UniParc]FASTAAdd to Basket

    Also known as: TRKC(IC108)

    The sequence of this isoform differs from the canonical sequence as follows:
         529-562: YVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSP → FGRIEGFAYGKRYVVMTSVHCHPCWFRFGGLEWL
         563-864: Missing.

    Show »
    Length:562
    Mass (Da):62,759
    Checksum:iA93D87527814D99C
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei529 – 61284YVQHI…GDGDP → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGFREIMLNPISLSGH SKPLNHGIYVEDVNVYFSKG RHGF in isoform IC158. CuratedVSP_002934Add
    BLAST
    Alternative sequencei529 – 59769YVQHI…TNLQH → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGELLPLTSLYEVKPL PLPVLILKT in isoform IC143. CuratedVSP_002932Add
    BLAST
    Alternative sequencei529 – 56739YVQHI…TKDKM → CFREIMLNPISLSGHSKPLN HGIYVEDVNVYFSKGRHGF in isoform IC113. CuratedVSP_002930Add
    BLAST
    Alternative sequencei529 – 56234YVQHI…YNLSP → FGRIEGFAYGKRYVVMTSVH CHPCWFRFGGLEWL in isoform IC108. CuratedVSP_002928Add
    BLAST
    Alternative sequencei563 – 864302Missing in isoform IC108. CuratedVSP_002929Add
    BLAST
    Alternative sequencei568 – 864297Missing in isoform IC113. CuratedVSP_002931Add
    BLAST
    Alternative sequencei598 – 864267Missing in isoform IC143. CuratedVSP_002933Add
    BLAST
    Alternative sequencei613 – 864252Missing in isoform IC158. CuratedVSP_002935Add
    BLAST
    Alternative sequencei712 – 73625Missing in isoform KI14 and isoform TRKC. 1 PublicationVSP_002936Add
    BLAST
    Alternative sequencei737 – 75014Missing in isoform KI25 and isoform TRKC. 1 PublicationVSP_002937Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L03813 mRNA. Translation: AAA42285.1.
    L14445 mRNA. Translation: AAA42282.1.
    L14446 mRNA. Translation: AAA42283.1.
    L14447 mRNA. Translation: AAA42284.1.
    S60953 mRNA. Translation: AAB26714.2.
    S62924 mRNA. Translation: AAB26716.2.
    S62933 mRNA. Translation: AAB26715.2.
    RefSeqiNP_001257584.1. NM_001270655.1. [Q03351-3]
    NP_001257585.1. NM_001270656.1. [Q03351-1]
    NP_062121.1. NM_019248.2. [Q03351-2]
    UniGeneiRn.9963.

    Genome annotation databases

    EnsembliENSRNOT00000025536; ENSRNOP00000025536; ENSRNOG00000018674. [Q03351-5]
    ENSRNOT00000041839; ENSRNOP00000046059; ENSRNOG00000018674. [Q03351-2]
    ENSRNOT00000045165; ENSRNOP00000049463; ENSRNOG00000018674. [Q03351-3]
    ENSRNOT00000046080; ENSRNOP00000044960; ENSRNOG00000018674. [Q03351-7]
    ENSRNOT00000046849; ENSRNOP00000044402; ENSRNOG00000018674. [Q03351-4]
    ENSRNOT00000047776; ENSRNOP00000050248; ENSRNOG00000018674. [Q03351-8]
    GeneIDi29613.
    KEGGirno:29613.
    UCSCiRGD:3214. rat. [Q03351-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L03813 mRNA. Translation: AAA42285.1 .
    L14445 mRNA. Translation: AAA42282.1 .
    L14446 mRNA. Translation: AAA42283.1 .
    L14447 mRNA. Translation: AAA42284.1 .
    S60953 mRNA. Translation: AAB26714.2 .
    S62924 mRNA. Translation: AAB26716.2 .
    S62933 mRNA. Translation: AAB26715.2 .
    RefSeqi NP_001257584.1. NM_001270655.1. [Q03351-3 ]
    NP_001257585.1. NM_001270656.1. [Q03351-1 ]
    NP_062121.1. NM_019248.2. [Q03351-2 ]
    UniGenei Rn.9963.

    3D structure databases

    ProteinModelPortali Q03351.
    SMRi Q03351. Positions 300-401.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    DIPi DIP-5718N.
    MINTi MINT-1208236.
    STRINGi 10116.ENSRNOP00000046935.

    Protein family/group databases

    MEROPSi I43.001.

    PTM databases

    PhosphoSitei Q03351.

    Proteomic databases

    PaxDbi Q03351.
    PRIDEi Q03351.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSRNOT00000025536 ; ENSRNOP00000025536 ; ENSRNOG00000018674 . [Q03351-5 ]
    ENSRNOT00000041839 ; ENSRNOP00000046059 ; ENSRNOG00000018674 . [Q03351-2 ]
    ENSRNOT00000045165 ; ENSRNOP00000049463 ; ENSRNOG00000018674 . [Q03351-3 ]
    ENSRNOT00000046080 ; ENSRNOP00000044960 ; ENSRNOG00000018674 . [Q03351-7 ]
    ENSRNOT00000046849 ; ENSRNOP00000044402 ; ENSRNOG00000018674 . [Q03351-4 ]
    ENSRNOT00000047776 ; ENSRNOP00000050248 ; ENSRNOG00000018674 . [Q03351-8 ]
    GeneIDi 29613.
    KEGGi rno:29613.
    UCSCi RGD:3214. rat. [Q03351-1 ]

    Organism-specific databases

    CTDi 4916.
    RGDi 3214. Ntrk3.

    Phylogenomic databases

    eggNOGi COG0515.
    GeneTreei ENSGT00730000110657.
    HOGENOMi HOG000264255.
    HOVERGENi HBG056735.
    InParanoidi Q03351.
    KOi K05101.
    OMAi NFVSIYE.
    OrthoDBi EOG7GTT32.
    PhylomeDBi Q03351.
    TreeFami TF106465.

    Enzyme and pathway databases

    BRENDAi 2.7.10.1. 5301.
    Reactomei REACT_219269. PLC-gamma1 signalling.

    Miscellaneous databases

    NextBioi 609800.
    PROi Q03351.

    Gene expression databases

    Genevestigatori Q03351.

    Family and domain databases

    Gene3Di 2.60.40.10. 2 hits.
    InterProi IPR000483. Cys-rich_flank_reg_C.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR011009. Kinase-like_dom.
    IPR001611. Leu-rich_rpt.
    IPR000372. LRR-contain_N.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR020446. Tyr_kin_neurotrophic_rcpt_3.
    IPR008266. Tyr_kinase_AS.
    IPR020635. Tyr_kinase_cat_dom.
    IPR020777. Tyr_kinase_NGF_rcpt.
    IPR002011. Tyr_kinase_rcpt_2_CS.
    [Graphical view ]
    Pfami PF07679. I-set. 2 hits.
    PF13855. LRR_8. 1 hit.
    PF01462. LRRNT. 1 hit.
    PF07714. Pkinase_Tyr. 2 hits.
    [Graphical view ]
    PRINTSi PR01939. NTKRECEPTOR.
    PR01942. NTKRECEPTOR3.
    PR00109. TYRKINASE.
    SMARTi SM00409. IG. 1 hit.
    SM00082. LRRCT. 1 hit.
    SM00013. LRRNT. 1 hit.
    SM00219. TyrKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 2 hits.
    PROSITEi PS50835. IG_LIKE. 1 hit.
    PS51450. LRR. 1 hit.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00109. PROTEIN_KINASE_TYR. 1 hit.
    PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of rat trkC and distribution of cells expressing messenger RNAs for members of the trk family in the rat central nervous system."
      Merlio J.P., Ernfors P., Jaber M., Persson H.
      Neuroscience 51:513-532(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM TRKC).
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
      Strain: Sprague-Dawley.
      Tissue: Brain.
    3. "The rat trkC locus encodes multiple neurogenic receptors that exhibit differential response to neurotrophin-3 in PC12 cells."
      Tsoulfas P., Soppet D., Escandon E., Tessarollo L., Mendoza-Ramirez J.-L., Rosenthal A., Nikolics K., Parada L.F.
      Neuron 10:975-990(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
      Tissue: Brain cortex and Hippocampus.
    4. "Identification and characterization of novel substrates of Trk receptors in developing neurons."
      Qian X., Riccio A., Zhang Y., Ginty D.D.
      Neuron 21:1017-1029(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SH2B2.
    5. "Association of the atypical protein kinase C-interacting protein p62/ZIP with nerve growth factor receptor TrkA regulates receptor trafficking and Erk5 signaling."
      Geetha T., Wooten M.W.
      J. Biol. Chem. 278:4730-4739(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SQSTM1.
    6. "A unique pathway for sustained neurotrophin signaling through an ankyrin-rich membrane-spanning protein."
      Arevalo J.C., Yano H., Teng K.K., Chao M.V.
      EMBO J. 23:2358-2368(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH KIDINS220.

    Entry informationi

    Entry nameiNTRK3_RAT
    AccessioniPrimary (citable) accession number: Q03351
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1993
    Last sequence update: February 1, 1994
    Last modified: October 1, 2014
    This is version 150 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3