Q03351 (NTRK3_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 137.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: NT-3 growth factor receptor EC=2.7.10.1 Alternative name(s): GP145-TrkC Short name=Trk-C Neurotrophic tyrosine kinase receptor type 3 TrkC tyrosine kinase | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 864 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for neurotrophin-3 (NTF3). This is a tyrosine-protein kinase receptor. Known substrates for the TRK receptors are SHC1, PI-3 kinase, and PLCG1. TrkC isoforms containing insertions within the kinase domain can autophosphorylate in response to NT-3, but cannot mediate downstream phenotypic responses. |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. |
| Subunit structure | Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. Binds SH2B2. Interacts with SQSTM1 and KIDINS220. Ref.4 Ref.5 Ref.6 |
| Subcellular location | |
| Tissue specificity | Widely expressed, mainly in the nervous tissue. |
| Post-translational modification | Ligand-mediated auto-phosphorylation. |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily. Contains 2 Ig-like C2-type (immunoglobulin-like) domains. Contains 2 LRR (leucine-rich) repeats. Contains 1 LRRCT domain. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform KI39 (identifier: Q03351-1) Also known as: TRKC(KI39); TRKC-39; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform TRKC (identifier: Q03351-2) The sequence of this isoform differs from the canonical sequence as follows: 712-736: Missing. 737-750: Missing. | ||||||
| Isoform KI14 (identifier: Q03351-3) Also known as: TRKC(KI14); TRKC-14; The sequence of this isoform differs from the canonical sequence as follows: 712-736: Missing. | ||||||
| Isoform KI25 (identifier: Q03351-4) Also known as: TRKC-25; The sequence of this isoform differs from the canonical sequence as follows: 737-750: Missing. | ||||||
| Isoform IC158 (identifier: Q03351-5) Also known as: TRKC(IC158); TRKCTK-; The sequence of this isoform differs from the canonical sequence as follows: 529-612: YVQHIKRRDI...FYGVCGDGDP → WVFSNIDNHG...VYFSKGRHGF 613-864: Missing. | ||||||
| Isoform IC143 (identifier: Q03351-6) Also known as: TRKC(IC143); The sequence of this isoform differs from the canonical sequence as follows: 529-597: YVQHIKRRDI...EAELLTNLQH → WVFSNIDNHG...LPLPVLILKT 598-864: Missing. | ||||||
| Isoform IC113 (identifier: Q03351-7) Also known as: TRKC(IC113); The sequence of this isoform differs from the canonical sequence as follows: 529-567: YVQHIKRRDI...YNLSPTKDKM → CFREIMLNPI...VYFSKGRHGF 568-864: Missing. | ||||||
| Isoform IC108 (identifier: Q03351-8) Also known as: TRKC(IC108); The sequence of this isoform differs from the canonical sequence as follows: 529-562: YVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSP → FGRIEGFAYGKRYVVMTSVHCHPCWFRFGGLEWL 563-864: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 31 | 31 | By similarity | ||||||||
| Chain | 32 – 864 | 833 | NT-3 growth factor receptor | PRO_0000016735 | |||||||
Regions | |||||||||||
| Topological domain | 32 – 429 | 398 | Extracellular Potential | ||||||||
| Transmembrane | 430 – 453 | 24 | Helical; Potential | ||||||||
| Topological domain | 454 – 864 | 411 | Cytoplasmic Potential | ||||||||
| Repeat | 104 – 125 | 22 | LRR 1 | ||||||||
| Repeat | 128 – 149 | 22 | LRR 2 | ||||||||
| Domain | 160 – 209 | 50 | LRRCT | ||||||||
| Domain | 210 – 300 | 91 | Ig-like C2-type 1 | ||||||||
| Domain | 309 – 382 | 74 | Ig-like C2-type 2 | ||||||||
| Domain | 538 – 853 | 316 | Protein kinase | ||||||||
| Nucleotide binding | 544 – 552 | 9 | ATP By similarity | ||||||||
Sites | |||||||||||
| Active site | 679 | 1 | Proton acceptor By similarity | ||||||||
| Binding site | 572 | 1 | ATP By similarity | ||||||||
| Site | 516 | 1 | Interaction with SHC1 By similarity | ||||||||
| Site | 859 | 1 | Interaction with PLC-gamma-1 By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 516 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Modified residue | 705 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Modified residue | 709 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Modified residue | 710 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Modified residue | 859 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Glycosylation | 68 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 72 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 79 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 133 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 163 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 203 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 218 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 232 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 259 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 267 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 272 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 294 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 375 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 388 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 320 ↔ 362 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 529 – 612 | 84 | YVQHI…GDGDP → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGFREIMLNPISLSGH SKPLNHGIYVEDVNVYFSKG RHGF in isoform IC158. | VSP_002934 | |||||||
| Alternative sequence | 529 – 597 | 69 | YVQHI…TNLQH → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGELLPLTSLYEVKPL PLPVLILKT in isoform IC143. | VSP_002932 | |||||||
| Alternative sequence | 529 – 567 | 39 | YVQHI…TKDKM → CFREIMLNPISLSGHSKPLN HGIYVEDVNVYFSKGRHGF in isoform IC113. | VSP_002930 | |||||||
| Alternative sequence | 529 – 562 | 34 | YVQHI…YNLSP → FGRIEGFAYGKRYVVMTSVH CHPCWFRFGGLEWL in isoform IC108. | VSP_002928 | |||||||
| Alternative sequence | 563 – 864 | 302 | Missing in isoform IC108. | VSP_002929 | |||||||
| Alternative sequence | 568 – 864 | 297 | Missing in isoform IC113. | VSP_002931 | |||||||
| Alternative sequence | 598 – 864 | 267 | Missing in isoform IC143. | VSP_002933 | |||||||
| Alternative sequence | 613 – 864 | 252 | Missing in isoform IC158. | VSP_002935 | |||||||
| Alternative sequence | 712 – 736 | 25 | Missing in isoform KI14 and isoform TRKC. | VSP_002936 | |||||||
| Alternative sequence | 737 – 750 | 14 | Missing in isoform KI25 and isoform TRKC. | VSP_002937 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Molecular cloning of rat trkC and distribution of cells expressing messenger RNAs for members of the trk family in the rat central nervous system." Merlio J.P., Ernfors P., Jaber M., Persson H. Neuroscience 51:513-532(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM TRKC). |
| [2] | "Alternative forms of rat TrkC with different functional capabilities." Valenzuela D.M., Maisonpierre P.C., Glass D.J., Rojas E., Nunez L., Kong Y., Gies D.R., Stitt T.N., Ip N.Y., Yancopoulos G.D. Neuron 10:963-974(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. Strain: Sprague-Dawley. Tissue: Brain. |
| [3] | "The rat trkC locus encodes multiple neurogenic receptors that exhibit differential response to neurotrophin-3 in PC12 cells." Tsoulfas P., Soppet D., Escandon E., Tessarollo L., Mendoza-Ramirez J.-L., Rosenthal A., Nikolics K., Parada L.F. Neuron 10:975-990(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. Tissue: Brain cortex and Hippocampus. |
| [4] | "Identification and characterization of novel substrates of Trk receptors in developing neurons." Qian X., Riccio A., Zhang Y., Ginty D.D. Neuron 21:1017-1029(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SH2B2. |
| [5] | "Association of the atypical protein kinase C-interacting protein p62/ZIP with nerve growth factor receptor TrkA regulates receptor trafficking and Erk5 signaling." Geetha T., Wooten M.W. J. Biol. Chem. 278:4730-4739(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SQSTM1. |
| [6] | "A unique pathway for sustained neurotrophin signaling through an ankyrin-rich membrane-spanning protein." Arevalo J.C., Yano H., Teng K.K., Chao M.V. EMBO J. 23:2358-2368(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KIDINS220. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L03813 mRNA. Translation: AAA42285.1. L14445 mRNA. Translation: AAA42282.1. L14446 mRNA. Translation: AAA42283.1. L14447 mRNA. Translation: AAA42284.1. S60953 mRNA. Translation: AAB26714.2. S62924 mRNA. Translation: AAB26716.2. S62933 mRNA. Translation: AAB26715.2. |
| IPI | IPI00194553. IPI00210007. IPI00231029. IPI00231030. IPI00231031. IPI00231032. IPI00231034. IPI00231035. |
| RefSeq | NP_001257584.1. NM_001270655.1. NP_001257585.1. NM_001270656.1. NP_062121.1. NM_019248.2. |
| UniGene | Rn.9963. |
3D structure databases | |
| ProteinModelPortal | Q03351. |
| SMR | Q03351. Positions 300-401. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-5718N. |
| MINT | MINT-1208236. |
| STRING | 10116.ENSRNOP00000046935. |
Protein family/group databases | |
| MEROPS | I43.001. |
PTM databases | |
| PhosphoSite | Q03351. |
Proteomic databases | |
| PaxDb | Q03351. |
| PRIDE | Q03351. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000025536; ENSRNOP00000025536; ENSRNOG00000018674. ENSRNOT00000041839; ENSRNOP00000046059; ENSRNOG00000018674. ENSRNOT00000045165; ENSRNOP00000049463; ENSRNOG00000018674. ENSRNOT00000046080; ENSRNOP00000044960; ENSRNOG00000018674. ENSRNOT00000046849; ENSRNOP00000044402; ENSRNOG00000018674. ENSRNOT00000047776; ENSRNOP00000050248; ENSRNOG00000018674. |
| GeneID | 29613. |
| KEGG | rno:29613. |
| UCSC | RGD:3214. rat. |
Organism-specific databases | |
| CTD | 4916. |
| RGD | 3214. Ntrk3. |
Phylogenomic databases | |
| eggNOG | COG0515. |
| GeneTree | ENSGT00700000104172. |
| HOGENOM | HOG000264255. |
| HOVERGEN | HBG056735. |
| InParanoid | Q03351. |
| KO | K05101. |
| OMA | NFVSIYE. |
| OrthoDB | EOG4W3SM8. |
Enzyme and pathway databases | |
| BRENDA | 2.7.10.1. 5301. |
| Reactome | REACT_111984. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | Q03351. |
| Genevestigator | Q03351. |
| GermOnline | ENSRNOG00000018674. Rattus norvegicus. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 2 hits. |
| InterPro | IPR000483. Cys-rich_flank_reg_C. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003599. Ig_sub. IPR011009. Kinase-like_dom. IPR001611. Leu-rich_rpt. IPR000372. LRR-contain_N. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR020446. Tyr_kin_neurotrophic_rcpt_3. IPR008266. Tyr_kinase_AS. IPR020635. Tyr_kinase_cat_dom. IPR020777. Tyr_kinase_NGF_rcpt. IPR002011. Tyr_kinase_rcpt_2_CS. [Graphical view] |
| Pfam | PF07679. I-set. 2 hits. PF01462. LRRNT. 1 hit. PF07714. Pkinase_Tyr. 2 hits. [Graphical view] |
| PRINTS | PR01939. NTKRECEPTOR. PR01942. NTKRECEPTOR3. PR00109. TYRKINASE. |
| SMART | SM00409. IG. 1 hit. SM00082. LRRCT. 1 hit. SM00013. LRRNT. 1 hit. SM00219. TyrKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS50835. IG_LIKE. 1 hit. PS51450. LRR. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. PS00239. RECEPTOR_TYR_KIN_II. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 609800. |
Entry information
| Entry name | NTRK3_RAT | ||||||||
| Accession | Primary (citable) accession number: Q03351 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
