Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q03351

- NTRK3_RAT

UniProt

Q03351 - NTRK3_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

NT-3 growth factor receptor

Gene

Ntrk3

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Receptor for neurotrophin-3 (NTF3). This is a tyrosine-protein kinase receptor. Known substrates for the TRK receptors are SHC1, PI-3 kinase, and PLCG1. TrkC isoforms containing insertions within the kinase domain can autophosphorylate in response to NT-3, but cannot mediate downstream phenotypic responses.

Catalytic activityi

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei516 – 5161Interaction with SHC1By similarity
Binding sitei572 – 5721ATPPROSITE-ProRule annotation
Active sitei679 – 6791Proton acceptorPROSITE-ProRule annotation
Sitei859 – 8591Interaction with PLC-gamma-1By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi544 – 5529ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. ephrin receptor binding Source: BHF-UCL
  3. neurotrophin receptor activity Source: RGD
  4. transmembrane receptor protein tyrosine kinase activity Source: UniProtKB-EC

GO - Biological processi

  1. activation of MAPK activity Source: Ensembl
  2. activation of protein kinase B activity Source: Ensembl
  3. activation of Ras GTPase activity Source: Ensembl
  4. cellular response to retinoic acid Source: RGD
  5. circadian rhythm Source: Ensembl
  6. cochlea development Source: RGD
  7. lens fiber cell differentiation Source: Ensembl
  8. mechanoreceptor differentiation Source: Ensembl
  9. modulation by virus of host transcription Source: RGD
  10. negative regulation of astrocyte differentiation Source: RGD
  11. negative regulation of cell death Source: RGD
  12. negative regulation of protein phosphorylation Source: Ensembl
  13. neuron fate specification Source: RGD
  14. neuron migration Source: RGD
  15. neurotrophin signaling pathway Source: GOC
  16. positive regulation of actin cytoskeleton reorganization Source: Ensembl
  17. positive regulation of axon extension involved in regeneration Source: Ensembl
  18. positive regulation of cell migration Source: Ensembl
  19. positive regulation of cell proliferation Source: Ensembl
  20. positive regulation of gene expression Source: Ensembl
  21. positive regulation of peptidyl-serine phosphorylation Source: Ensembl
  22. positive regulation of positive chemotaxis Source: Ensembl
  23. protein autophosphorylation Source: RGD
  24. response to axon injury Source: RGD
  25. response to corticosterone Source: RGD
  26. response to ethanol Source: RGD
  27. transmembrane receptor protein tyrosine kinase signaling pathway Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase

Keywords - Biological processi

Differentiation, Neurogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.10.1. 5301.
ReactomeiREACT_219269. PLC-gamma1 signalling.

Protein family/group databases

MEROPSiI43.001.

Names & Taxonomyi

Protein namesi
Recommended name:
NT-3 growth factor receptor (EC:2.7.10.1)
Alternative name(s):
GP145-TrkC
Short name:
Trk-C
Neurotrophic tyrosine kinase receptor type 3
TrkC tyrosine kinase
Gene namesi
Name:Ntrk3
Synonyms:Trkc
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Chromosome 1

Organism-specific databases

RGDi3214. Ntrk3.

Subcellular locationi

GO - Cellular componenti

  1. Golgi membrane Source: Reactome
  2. integral component of plasma membrane Source: InterPro
  3. membrane Source: RGD
  4. plasma membrane Source: RGD
  5. receptor complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3131By similarityAdd
BLAST
Chaini32 – 864833NT-3 growth factor receptorPRO_0000016735Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi68 – 681N-linked (GlcNAc...)Sequence Analysis
Glycosylationi72 – 721N-linked (GlcNAc...)Sequence Analysis
Glycosylationi79 – 791N-linked (GlcNAc...)Sequence Analysis
Glycosylationi133 – 1331N-linked (GlcNAc...)Sequence Analysis
Glycosylationi163 – 1631N-linked (GlcNAc...)Sequence Analysis
Glycosylationi203 – 2031N-linked (GlcNAc...)Sequence Analysis
Glycosylationi218 – 2181N-linked (GlcNAc...)Sequence Analysis
Glycosylationi232 – 2321N-linked (GlcNAc...)Sequence Analysis
Glycosylationi259 – 2591N-linked (GlcNAc...)Sequence Analysis
Glycosylationi267 – 2671N-linked (GlcNAc...)Sequence Analysis
Glycosylationi272 – 2721N-linked (GlcNAc...)Sequence Analysis
Glycosylationi294 – 2941N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi320 ↔ 362PROSITE-ProRule annotation
Glycosylationi375 – 3751N-linked (GlcNAc...)Sequence Analysis
Glycosylationi388 – 3881N-linked (GlcNAc...)Sequence Analysis
Modified residuei516 – 5161Phosphotyrosine; by autocatalysisBy similarity
Modified residuei705 – 7051Phosphotyrosine; by autocatalysisBy similarity
Modified residuei709 – 7091Phosphotyrosine; by autocatalysisBy similarity
Modified residuei710 – 7101Phosphotyrosine; by autocatalysisBy similarity
Modified residuei859 – 8591Phosphotyrosine; by autocatalysisBy similarity

Post-translational modificationi

Ligand-mediated auto-phosphorylation.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ03351.
PRIDEiQ03351.

PTM databases

PhosphoSiteiQ03351.

Expressioni

Tissue specificityi

Widely expressed, mainly in the nervous tissue.

Gene expression databases

ExpressionAtlasiQ03351. baseline.
GenevestigatoriQ03351.

Interactioni

Subunit structurei

Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. Binds SH2B2. Interacts with SQSTM1 and KIDINS220.3 Publications

Protein-protein interaction databases

DIPiDIP-5718N.
MINTiMINT-1208236.
STRINGi10116.ENSRNOP00000046935.

Structurei

3D structure databases

ProteinModelPortaliQ03351.
SMRiQ03351. Positions 300-401.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini32 – 429398ExtracellularSequence AnalysisAdd
BLAST
Topological domaini454 – 864411CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei430 – 45324HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati104 – 12522LRR 1Add
BLAST
Repeati128 – 14922LRR 2Add
BLAST
Domaini160 – 20950LRRCTAdd
BLAST
Domaini210 – 30091Ig-like C2-type 1Add
BLAST
Domaini309 – 38274Ig-like C2-type 2Add
BLAST
Domaini538 – 853316Protein kinasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation
Contains 2 LRR (leucine-rich) repeats.Curated
Contains 1 LRRCT domain.Curated
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00760000118818.
HOGENOMiHOG000264255.
HOVERGENiHBG056735.
InParanoidiQ03351.
KOiK05101.
OMAiNFVSIYE.
OrthoDBiEOG7GTT32.
PhylomeDBiQ03351.
TreeFamiTF106465.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR001611. Leu-rich_rpt.
IPR000372. LRR-contain_N.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF01462. LRRNT. 1 hit.
PF07714. Pkinase_Tyr. 2 hits.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 2 hits.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform KI39 (identifier: Q03351-1) [UniParc]FASTAAdd to Basket

Also known as: TRKC(KI39), TRKC-39

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVSLCPAKC SFWRIFLLGS VWLDYVGSVL ACPANCVCSK TEINCRRPDD
60 70 80 90 100
GNLFPLLEGQ DSGNSNGNAS INITDISRNI TSIHIENWRG LHTLNAVDME
110 120 130 140 150
LYTGLQKLTI KNSGLRNIQP RAFAKNPHLR YINLSSNRLT TLSWQLFQTL
160 170 180 190 200
SLRELRLEQN FFNCSCDIRW MQLWQEQGEA RLDSQSLYCI SADGSQLPLF
210 220 230 240 250
RMNISQCDLP EISVSHVNLT VREGDNAVIT CNGSGSPLPD VDWIVTGLQS
260 270 280 290 300
INTHQTNLNW TNVHAINLTL VNVTSEDNGF TLTCIAENVV GMSNASVALT
310 320 330 340 350
VYYPPRVVSL VEPEVRLEHC IEFVVRGNPT PTLHWLYNGQ PLRESKIIHM
360 370 380 390 400
DYYQEGEVSE GCLLFNKPTH YNNGNYTLIA KNALGTANQT INGHFLKEPF
410 420 430 440 450
PESTDFFDFE SDASPTPPIT VTHKPEEDTF GVSIAVGLAA FACVLLVVLF
460 470 480 490 500
IMINKYGRRS KFGMKGPVAV ISGEEDSASP LHHINHGITT PSSLDAGPDT
510 520 530 540 550
VVIGMTRIPV IENPQYFRQG HNCHKPDTYV QHIKRRDIVL KRELGEGAFG
560 570 580 590 600
KVFLAECYNL SPTKDKMLVA VKALKDPTLA ARKDFQREAE LLTNLQHEHI
610 620 630 640 650
VKFYGVCGDG DPLIMVFEYM KHGDLNKFLR AHGPDAMILV DGQPRQAKGE
660 670 680 690 700
LGLSQMLHIA SQIASGMVYL ASQHFVHRDL ATRNCLVGAN LLVKIGDFGM
710 720 730 740 750
SRDVYSTDYY REGPYQKGPF SVSWQQQRLA ASAASTLFNP SGNDFCIWCE
760 770 780 790 800
VGGHTMLPIR WMPPESIMYR KFTTESDVWS FGVILWEIFT YGKQPWFQLS
810 820 830 840 850
NTEVIECITQ GRVLERPRVC PKEVYDVMLG CWQREPQQRL NIKEIYKILH
860
ALGKATPIYL DILG
Length:864
Mass (Da):97,064
Last modified:February 1, 1994 - v2
Checksum:iA202E993E208F636
GO
Isoform TRKC (identifier: Q03351-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     712-736: Missing.
     737-750: Missing.

Show »
Length:825
Mass (Da):92,760
Checksum:i4DE08AB546CC5BD6
GO
Isoform KI14 (identifier: Q03351-3) [UniParc]FASTAAdd to Basket

Also known as: TRKC(KI14), TRKC-14

The sequence of this isoform differs from the canonical sequence as follows:
     712-736: Missing.

Show »
Length:839
Mass (Da):94,387
Checksum:i78F3574FD80D983A
GO
Isoform KI25 (identifier: Q03351-4) [UniParc]FASTAAdd to Basket

Also known as: TRKC-25

The sequence of this isoform differs from the canonical sequence as follows:
     737-750: Missing.

Show »
Length:850
Mass (Da):95,437
Checksum:iC4CDDD82FF313324
GO
Isoform IC158 (identifier: Q03351-5) [UniParc]FASTAAdd to Basket

Also known as: TRKC(IC158), TRKCTK-

The sequence of this isoform differs from the canonical sequence as follows:
     529-612: YVQHIKRRDI...FYGVCGDGDP → WVFSNIDNHG...VYFSKGRHGF
     613-864: Missing.

Show »
Length:612
Mass (Da):68,387
Checksum:i376F0F449792CE46
GO
Isoform IC143 (identifier: Q03351-6) [UniParc]FASTAAdd to Basket

Also known as: TRKC(IC143)

The sequence of this isoform differs from the canonical sequence as follows:
     529-597: YVQHIKRRDI...EAELLTNLQH → WVFSNIDNHG...LPLPVLILKT
     598-864: Missing.

Show »
Length:597
Mass (Da):66,618
Checksum:i202BBA3831315D3D
GO
Isoform IC113 (identifier: Q03351-7) [UniParc]FASTAAdd to Basket

Also known as: TRKC(IC113)

The sequence of this isoform differs from the canonical sequence as follows:
     529-567: YVQHIKRRDI...YNLSPTKDKM → CFREIMLNPI...VYFSKGRHGF
     568-864: Missing.

Show »
Length:567
Mass (Da):63,172
Checksum:i87C245CD9147639B
GO
Isoform IC108 (identifier: Q03351-8) [UniParc]FASTAAdd to Basket

Also known as: TRKC(IC108)

The sequence of this isoform differs from the canonical sequence as follows:
     529-562: YVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSP → FGRIEGFAYGKRYVVMTSVHCHPCWFRFGGLEWL
     563-864: Missing.

Show »
Length:562
Mass (Da):62,759
Checksum:iA93D87527814D99C
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei529 – 61284YVQHI…GDGDP → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGFREIMLNPISLSGH SKPLNHGIYVEDVNVYFSKG RHGF in isoform IC158. CuratedVSP_002934Add
BLAST
Alternative sequencei529 – 59769YVQHI…TNLQH → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGELLPLTSLYEVKPL PLPVLILKT in isoform IC143. CuratedVSP_002932Add
BLAST
Alternative sequencei529 – 56739YVQHI…TKDKM → CFREIMLNPISLSGHSKPLN HGIYVEDVNVYFSKGRHGF in isoform IC113. CuratedVSP_002930Add
BLAST
Alternative sequencei529 – 56234YVQHI…YNLSP → FGRIEGFAYGKRYVVMTSVH CHPCWFRFGGLEWL in isoform IC108. CuratedVSP_002928Add
BLAST
Alternative sequencei563 – 864302Missing in isoform IC108. CuratedVSP_002929Add
BLAST
Alternative sequencei568 – 864297Missing in isoform IC113. CuratedVSP_002931Add
BLAST
Alternative sequencei598 – 864267Missing in isoform IC143. CuratedVSP_002933Add
BLAST
Alternative sequencei613 – 864252Missing in isoform IC158. CuratedVSP_002935Add
BLAST
Alternative sequencei712 – 73625Missing in isoform KI14 and isoform TRKC. 1 PublicationVSP_002936Add
BLAST
Alternative sequencei737 – 75014Missing in isoform KI25 and isoform TRKC. 1 PublicationVSP_002937Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L03813 mRNA. Translation: AAA42285.1.
L14445 mRNA. Translation: AAA42282.1.
L14446 mRNA. Translation: AAA42283.1.
L14447 mRNA. Translation: AAA42284.1.
S60953 mRNA. Translation: AAB26714.2.
S62924 mRNA. Translation: AAB26716.2.
S62933 mRNA. Translation: AAB26715.2.
RefSeqiNP_001257584.1. NM_001270655.1. [Q03351-3]
NP_001257585.1. NM_001270656.1. [Q03351-1]
NP_062121.1. NM_019248.2. [Q03351-2]
UniGeneiRn.9963.

Genome annotation databases

EnsembliENSRNOT00000025536; ENSRNOP00000025536; ENSRNOG00000018674. [Q03351-5]
ENSRNOT00000041839; ENSRNOP00000046059; ENSRNOG00000018674. [Q03351-2]
ENSRNOT00000045165; ENSRNOP00000049463; ENSRNOG00000018674. [Q03351-3]
ENSRNOT00000046080; ENSRNOP00000044960; ENSRNOG00000018674. [Q03351-7]
ENSRNOT00000046849; ENSRNOP00000044402; ENSRNOG00000018674. [Q03351-4]
ENSRNOT00000047776; ENSRNOP00000050248; ENSRNOG00000018674. [Q03351-8]
GeneIDi29613.
KEGGirno:29613.
UCSCiRGD:3214. rat. [Q03351-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L03813 mRNA. Translation: AAA42285.1 .
L14445 mRNA. Translation: AAA42282.1 .
L14446 mRNA. Translation: AAA42283.1 .
L14447 mRNA. Translation: AAA42284.1 .
S60953 mRNA. Translation: AAB26714.2 .
S62924 mRNA. Translation: AAB26716.2 .
S62933 mRNA. Translation: AAB26715.2 .
RefSeqi NP_001257584.1. NM_001270655.1. [Q03351-3 ]
NP_001257585.1. NM_001270656.1. [Q03351-1 ]
NP_062121.1. NM_019248.2. [Q03351-2 ]
UniGenei Rn.9963.

3D structure databases

ProteinModelPortali Q03351.
SMRi Q03351. Positions 300-401.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

DIPi DIP-5718N.
MINTi MINT-1208236.
STRINGi 10116.ENSRNOP00000046935.

Protein family/group databases

MEROPSi I43.001.

PTM databases

PhosphoSitei Q03351.

Proteomic databases

PaxDbi Q03351.
PRIDEi Q03351.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSRNOT00000025536 ; ENSRNOP00000025536 ; ENSRNOG00000018674 . [Q03351-5 ]
ENSRNOT00000041839 ; ENSRNOP00000046059 ; ENSRNOG00000018674 . [Q03351-2 ]
ENSRNOT00000045165 ; ENSRNOP00000049463 ; ENSRNOG00000018674 . [Q03351-3 ]
ENSRNOT00000046080 ; ENSRNOP00000044960 ; ENSRNOG00000018674 . [Q03351-7 ]
ENSRNOT00000046849 ; ENSRNOP00000044402 ; ENSRNOG00000018674 . [Q03351-4 ]
ENSRNOT00000047776 ; ENSRNOP00000050248 ; ENSRNOG00000018674 . [Q03351-8 ]
GeneIDi 29613.
KEGGi rno:29613.
UCSCi RGD:3214. rat. [Q03351-1 ]

Organism-specific databases

CTDi 4916.
RGDi 3214. Ntrk3.

Phylogenomic databases

eggNOGi COG0515.
GeneTreei ENSGT00760000118818.
HOGENOMi HOG000264255.
HOVERGENi HBG056735.
InParanoidi Q03351.
KOi K05101.
OMAi NFVSIYE.
OrthoDBi EOG7GTT32.
PhylomeDBi Q03351.
TreeFami TF106465.

Enzyme and pathway databases

BRENDAi 2.7.10.1. 5301.
Reactomei REACT_219269. PLC-gamma1 signalling.

Miscellaneous databases

NextBioi 609800.
PROi Q03351.

Gene expression databases

ExpressionAtlasi Q03351. baseline.
Genevestigatori Q03351.

Family and domain databases

Gene3Di 2.60.40.10. 2 hits.
InterProi IPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR001611. Leu-rich_rpt.
IPR000372. LRR-contain_N.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view ]
Pfami PF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF01462. LRRNT. 1 hit.
PF07714. Pkinase_Tyr. 2 hits.
[Graphical view ]
PRINTSi PR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTi SM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 2 hits.
PROSITEi PS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Molecular cloning of rat trkC and distribution of cells expressing messenger RNAs for members of the trk family in the rat central nervous system."
    Merlio J.P., Ernfors P., Jaber M., Persson H.
    Neuroscience 51:513-532(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM TRKC).
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
    Strain: Sprague-Dawley.
    Tissue: Brain.
  3. "The rat trkC locus encodes multiple neurogenic receptors that exhibit differential response to neurotrophin-3 in PC12 cells."
    Tsoulfas P., Soppet D., Escandon E., Tessarollo L., Mendoza-Ramirez J.-L., Rosenthal A., Nikolics K., Parada L.F.
    Neuron 10:975-990(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
    Tissue: Brain cortex and Hippocampus.
  4. "Identification and characterization of novel substrates of Trk receptors in developing neurons."
    Qian X., Riccio A., Zhang Y., Ginty D.D.
    Neuron 21:1017-1029(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SH2B2.
  5. "Association of the atypical protein kinase C-interacting protein p62/ZIP with nerve growth factor receptor TrkA regulates receptor trafficking and Erk5 signaling."
    Geetha T., Wooten M.W.
    J. Biol. Chem. 278:4730-4739(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SQSTM1.
  6. "A unique pathway for sustained neurotrophin signaling through an ankyrin-rich membrane-spanning protein."
    Arevalo J.C., Yano H., Teng K.K., Chao M.V.
    EMBO J. 23:2358-2368(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KIDINS220.

Entry informationi

Entry nameiNTRK3_RAT
AccessioniPrimary (citable) accession number: Q03351
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: February 1, 1994
Last modified: October 29, 2014
This is version 151 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3