Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NT-3 growth factor receptor

Gene

Ntrk3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor tyrosine kinase involved in nervous system and probably heart development. Upon binding of its ligand NTF3/neurotrophin-3, NTRK3 autophosphorylates and activates different signaling pathways, including the phosphatidylinositol 3-kinase/AKT and the MAPK pathways, that control cell survival and differentiation (By similarity). NTRK3 isoforms containing insertions within the kinase domain can autophosphorylate in response to NTF3/neurotrophin-3, but cannot mediate downstream phenotypic responses (PubMed:8494647, PubMed:8494648).By similarity2 Publications

Catalytic activityi

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei572ATPPROSITE-ProRule annotation1
Active sitei679Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi544 – 552ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • GPI-linked ephrin receptor activity Source: BHF-UCL
  • neurotrophin receptor activity Source: RGD
  • transmembrane receptor protein serine/threonine kinase activity Source: Reactome

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase

Keywords - Biological processi

Differentiation, Neurogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.10.1. 5301.
ReactomeiR-RNO-167021. PLC-gamma1 signalling.
R-RNO-167044. Signalling to RAS.
R-RNO-170968. Frs2-mediated activation.
R-RNO-170984. ARMS-mediated activation.
R-RNO-177504. Retrograde neurotrophin signalling.
R-RNO-187024. NGF-independant TRKA activation.
R-RNO-187042. TRKA activation by NGF.
R-RNO-187706. Signalling to p38 via RIT and RIN.
R-RNO-198745. Signalling to STAT3.

Names & Taxonomyi

Protein namesi
Recommended name:
NT-3 growth factor receptor (EC:2.7.10.1)
Alternative name(s):
GP145-TrkC
Short name:
Trk-C
Neurotrophic tyrosine kinase receptor type 3
TrkC tyrosine kinase
Gene namesi
Name:Ntrk3
Synonyms:Trkc
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 1

Organism-specific databases

RGDi3214. Ntrk3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini32 – 429ExtracellularSequence analysisAdd BLAST398
Transmembranei430 – 453HelicalSequence analysisAdd BLAST24
Topological domaini454 – 864CytoplasmicSequence analysisAdd BLAST411

GO - Cellular componenti

  • Golgi membrane Source: Reactome
  • integral component of plasma membrane Source: InterPro
  • membrane Source: RGD
  • plasma membrane Source: RGD
  • receptor complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 31By similarityAdd BLAST31
ChainiPRO_000001673532 – 864NT-3 growth factor receptorAdd BLAST833

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi68N-linked (GlcNAc...)Sequence analysis1
Glycosylationi72N-linked (GlcNAc...)Sequence analysis1
Glycosylationi79N-linked (GlcNAc...)Sequence analysis1
Glycosylationi133N-linked (GlcNAc...)Sequence analysis1
Glycosylationi163N-linked (GlcNAc...)Sequence analysis1
Glycosylationi203N-linked (GlcNAc...)Sequence analysis1
Glycosylationi218N-linked (GlcNAc...)Sequence analysis1
Glycosylationi232N-linked (GlcNAc...)Sequence analysis1
Glycosylationi259N-linked (GlcNAc...)Sequence analysis1
Glycosylationi267N-linked (GlcNAc...)Sequence analysis1
Glycosylationi272N-linked (GlcNAc...)Sequence analysis1
Glycosylationi294N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi320 ↔ 362PROSITE-ProRule annotation
Glycosylationi375N-linked (GlcNAc...)Sequence analysis1
Glycosylationi388N-linked (GlcNAc...)Sequence analysis1
Modified residuei493PhosphoserineBy similarity1
Modified residuei516Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei705Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei709Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei710Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei859Phosphotyrosine; by autocatalysisBy similarity1

Post-translational modificationi

Ligand-mediated auto-phosphorylation.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ03351.
PRIDEiQ03351.

PTM databases

iPTMnetiQ03351.
PhosphoSitePlusiQ03351.

Expressioni

Tissue specificityi

Widely expressed, mainly in the nervous tissue.

Gene expression databases

BgeeiENSRNOG00000018674.
ExpressionAtlasiQ03351. baseline and differential.
GenevisibleiQ03351. RN.

Interactioni

Subunit structurei

Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. Binds SH2B2. Interacts with SQSTM1 and KIDINS220.3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei516Interaction with SHC1By similarity1
Sitei859Interaction with PLC-gamma-1By similarity1

Protein-protein interaction databases

BioGridi248241. 2 interactors.
DIPiDIP-5718N.
MINTiMINT-1208236.
STRINGi10116.ENSRNOP00000044402.

Structurei

3D structure databases

ProteinModelPortaliQ03351.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati104 – 125LRR 1Add BLAST22
Repeati128 – 149LRR 2Add BLAST22
Domaini160 – 209LRRCTAdd BLAST50
Domaini210 – 300Ig-like C2-type 1Add BLAST91
Domaini309 – 382Ig-like C2-type 2Add BLAST74
Domaini538 – 853Protein kinasePROSITE-ProRule annotationAdd BLAST316

Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation
Contains 2 LRR (leucine-rich) repeats.Curated
Contains 1 LRRCT domain.Curated
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1026. Eukaryota.
ENOG410YGKQ. LUCA.
GeneTreeiENSGT00760000118818.
HOGENOMiHOG000264255.
HOVERGENiHBG056735.
InParanoidiQ03351.
KOiK05101.
OMAiNFVSIYE.
OrthoDBiEOG091G01JY.
PhylomeDBiQ03351.
TreeFamiTF106465.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
3.80.10.10. 1 hit.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR013151. Immunoglobulin.
IPR011009. Kinase-like_dom.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR000372. LRRNT.
IPR031635. NTRK_C2.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 1 hit.
PF00047. ig. 1 hit.
PF13855. LRR_8. 1 hit.
PF01462. LRRNT. 1 hit.
PF07714. Pkinase_Tyr. 2 hits.
PF16920. TPKR_C2. 1 hit.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
SSF52058. SSF52058. 1 hit.
SSF56112. SSF56112. 2 hits.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform KI39 (identifier: Q03351-1) [UniParc]FASTAAdd to basket
Also known as: TRKC(KI39), TRKC-39

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVSLCPAKC SFWRIFLLGS VWLDYVGSVL ACPANCVCSK TEINCRRPDD
60 70 80 90 100
GNLFPLLEGQ DSGNSNGNAS INITDISRNI TSIHIENWRG LHTLNAVDME
110 120 130 140 150
LYTGLQKLTI KNSGLRNIQP RAFAKNPHLR YINLSSNRLT TLSWQLFQTL
160 170 180 190 200
SLRELRLEQN FFNCSCDIRW MQLWQEQGEA RLDSQSLYCI SADGSQLPLF
210 220 230 240 250
RMNISQCDLP EISVSHVNLT VREGDNAVIT CNGSGSPLPD VDWIVTGLQS
260 270 280 290 300
INTHQTNLNW TNVHAINLTL VNVTSEDNGF TLTCIAENVV GMSNASVALT
310 320 330 340 350
VYYPPRVVSL VEPEVRLEHC IEFVVRGNPT PTLHWLYNGQ PLRESKIIHM
360 370 380 390 400
DYYQEGEVSE GCLLFNKPTH YNNGNYTLIA KNALGTANQT INGHFLKEPF
410 420 430 440 450
PESTDFFDFE SDASPTPPIT VTHKPEEDTF GVSIAVGLAA FACVLLVVLF
460 470 480 490 500
IMINKYGRRS KFGMKGPVAV ISGEEDSASP LHHINHGITT PSSLDAGPDT
510 520 530 540 550
VVIGMTRIPV IENPQYFRQG HNCHKPDTYV QHIKRRDIVL KRELGEGAFG
560 570 580 590 600
KVFLAECYNL SPTKDKMLVA VKALKDPTLA ARKDFQREAE LLTNLQHEHI
610 620 630 640 650
VKFYGVCGDG DPLIMVFEYM KHGDLNKFLR AHGPDAMILV DGQPRQAKGE
660 670 680 690 700
LGLSQMLHIA SQIASGMVYL ASQHFVHRDL ATRNCLVGAN LLVKIGDFGM
710 720 730 740 750
SRDVYSTDYY REGPYQKGPF SVSWQQQRLA ASAASTLFNP SGNDFCIWCE
760 770 780 790 800
VGGHTMLPIR WMPPESIMYR KFTTESDVWS FGVILWEIFT YGKQPWFQLS
810 820 830 840 850
NTEVIECITQ GRVLERPRVC PKEVYDVMLG CWQREPQQRL NIKEIYKILH
860
ALGKATPIYL DILG
Length:864
Mass (Da):97,064
Last modified:February 1, 1994 - v2
Checksum:iA202E993E208F636
GO
Isoform TRKC (identifier: Q03351-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     712-736: Missing.
     737-750: Missing.

Show »
Length:825
Mass (Da):92,760
Checksum:i4DE08AB546CC5BD6
GO
Isoform KI14 (identifier: Q03351-3) [UniParc]FASTAAdd to basket
Also known as: TRKC(KI14), TRKC-14

The sequence of this isoform differs from the canonical sequence as follows:
     712-736: Missing.

Show »
Length:839
Mass (Da):94,387
Checksum:i78F3574FD80D983A
GO
Isoform KI25 (identifier: Q03351-4) [UniParc]FASTAAdd to basket
Also known as: TRKC-25

The sequence of this isoform differs from the canonical sequence as follows:
     737-750: Missing.

Show »
Length:850
Mass (Da):95,437
Checksum:iC4CDDD82FF313324
GO
Isoform IC158 (identifier: Q03351-5) [UniParc]FASTAAdd to basket
Also known as: TRKC(IC158), TRKCTK-

The sequence of this isoform differs from the canonical sequence as follows:
     529-612: YVQHIKRRDI...FYGVCGDGDP → WVFSNIDNHG...VYFSKGRHGF
     613-864: Missing.

Show »
Length:612
Mass (Da):68,387
Checksum:i376F0F449792CE46
GO
Isoform IC143 (identifier: Q03351-6) [UniParc]FASTAAdd to basket
Also known as: TRKC(IC143)

The sequence of this isoform differs from the canonical sequence as follows:
     529-597: YVQHIKRRDI...EAELLTNLQH → WVFSNIDNHG...LPLPVLILKT
     598-864: Missing.

Show »
Length:597
Mass (Da):66,618
Checksum:i202BBA3831315D3D
GO
Isoform IC113 (identifier: Q03351-7) [UniParc]FASTAAdd to basket
Also known as: TRKC(IC113)

The sequence of this isoform differs from the canonical sequence as follows:
     529-567: YVQHIKRRDI...YNLSPTKDKM → CFREIMLNPI...VYFSKGRHGF
     568-864: Missing.

Show »
Length:567
Mass (Da):63,172
Checksum:i87C245CD9147639B
GO
Isoform IC108 (identifier: Q03351-8) [UniParc]FASTAAdd to basket
Also known as: TRKC(IC108)

The sequence of this isoform differs from the canonical sequence as follows:
     529-562: YVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSP → FGRIEGFAYGKRYVVMTSVHCHPCWFRFGGLEWL
     563-864: Missing.

Show »
Length:562
Mass (Da):62,759
Checksum:iA93D87527814D99C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002934529 – 612YVQHI…GDGDP → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGFREIMLNPISLSGH SKPLNHGIYVEDVNVYFSKG RHGF in isoform IC158. CuratedAdd BLAST84
Alternative sequenceiVSP_002932529 – 597YVQHI…TNLQH → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGELLPLTSLYEVKPL PLPVLILKT in isoform IC143. CuratedAdd BLAST69
Alternative sequenceiVSP_002930529 – 567YVQHI…TKDKM → CFREIMLNPISLSGHSKPLN HGIYVEDVNVYFSKGRHGF in isoform IC113. CuratedAdd BLAST39
Alternative sequenceiVSP_002928529 – 562YVQHI…YNLSP → FGRIEGFAYGKRYVVMTSVH CHPCWFRFGGLEWL in isoform IC108. CuratedAdd BLAST34
Alternative sequenceiVSP_002929563 – 864Missing in isoform IC108. CuratedAdd BLAST302
Alternative sequenceiVSP_002931568 – 864Missing in isoform IC113. CuratedAdd BLAST297
Alternative sequenceiVSP_002933598 – 864Missing in isoform IC143. CuratedAdd BLAST267
Alternative sequenceiVSP_002935613 – 864Missing in isoform IC158. CuratedAdd BLAST252
Alternative sequenceiVSP_002936712 – 736Missing in isoform KI14 and isoform TRKC. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_002937737 – 750Missing in isoform KI25 and isoform TRKC. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L03813 mRNA. Translation: AAA42285.1.
L14445 mRNA. Translation: AAA42282.1.
L14446 mRNA. Translation: AAA42283.1.
L14447 mRNA. Translation: AAA42284.1.
S60953 mRNA. Translation: AAB26714.2.
S62924 mRNA. Translation: AAB26716.2.
S62933 mRNA. Translation: AAB26715.2.
RefSeqiNP_001257584.1. NM_001270655.1. [Q03351-3]
NP_001257585.1. NM_001270656.1. [Q03351-1]
NP_062121.1. NM_019248.2. [Q03351-2]
XP_017444550.1. XM_017589061.1. [Q03351-4]
UniGeneiRn.9963.

Genome annotation databases

EnsembliENSRNOT00000025536; ENSRNOP00000025536; ENSRNOG00000018674. [Q03351-5]
ENSRNOT00000041839; ENSRNOP00000046059; ENSRNOG00000018674. [Q03351-2]
ENSRNOT00000045165; ENSRNOP00000049463; ENSRNOG00000018674. [Q03351-3]
ENSRNOT00000046849; ENSRNOP00000044402; ENSRNOG00000018674. [Q03351-1]
GeneIDi29613.
KEGGirno:29613.
UCSCiRGD:3214. rat. [Q03351-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L03813 mRNA. Translation: AAA42285.1.
L14445 mRNA. Translation: AAA42282.1.
L14446 mRNA. Translation: AAA42283.1.
L14447 mRNA. Translation: AAA42284.1.
S60953 mRNA. Translation: AAB26714.2.
S62924 mRNA. Translation: AAB26716.2.
S62933 mRNA. Translation: AAB26715.2.
RefSeqiNP_001257584.1. NM_001270655.1. [Q03351-3]
NP_001257585.1. NM_001270656.1. [Q03351-1]
NP_062121.1. NM_019248.2. [Q03351-2]
XP_017444550.1. XM_017589061.1. [Q03351-4]
UniGeneiRn.9963.

3D structure databases

ProteinModelPortaliQ03351.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi248241. 2 interactors.
DIPiDIP-5718N.
MINTiMINT-1208236.
STRINGi10116.ENSRNOP00000044402.

PTM databases

iPTMnetiQ03351.
PhosphoSitePlusiQ03351.

Proteomic databases

PaxDbiQ03351.
PRIDEiQ03351.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000025536; ENSRNOP00000025536; ENSRNOG00000018674. [Q03351-5]
ENSRNOT00000041839; ENSRNOP00000046059; ENSRNOG00000018674. [Q03351-2]
ENSRNOT00000045165; ENSRNOP00000049463; ENSRNOG00000018674. [Q03351-3]
ENSRNOT00000046849; ENSRNOP00000044402; ENSRNOG00000018674. [Q03351-1]
GeneIDi29613.
KEGGirno:29613.
UCSCiRGD:3214. rat. [Q03351-1]

Organism-specific databases

CTDi4916.
RGDi3214. Ntrk3.

Phylogenomic databases

eggNOGiKOG1026. Eukaryota.
ENOG410YGKQ. LUCA.
GeneTreeiENSGT00760000118818.
HOGENOMiHOG000264255.
HOVERGENiHBG056735.
InParanoidiQ03351.
KOiK05101.
OMAiNFVSIYE.
OrthoDBiEOG091G01JY.
PhylomeDBiQ03351.
TreeFamiTF106465.

Enzyme and pathway databases

BRENDAi2.7.10.1. 5301.
ReactomeiR-RNO-167021. PLC-gamma1 signalling.
R-RNO-167044. Signalling to RAS.
R-RNO-170968. Frs2-mediated activation.
R-RNO-170984. ARMS-mediated activation.
R-RNO-177504. Retrograde neurotrophin signalling.
R-RNO-187024. NGF-independant TRKA activation.
R-RNO-187042. TRKA activation by NGF.
R-RNO-187706. Signalling to p38 via RIT and RIN.
R-RNO-198745. Signalling to STAT3.

Miscellaneous databases

PROiQ03351.

Gene expression databases

BgeeiENSRNOG00000018674.
ExpressionAtlasiQ03351. baseline and differential.
GenevisibleiQ03351. RN.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
3.80.10.10. 1 hit.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR013151. Immunoglobulin.
IPR011009. Kinase-like_dom.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR000372. LRRNT.
IPR031635. NTRK_C2.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 1 hit.
PF00047. ig. 1 hit.
PF13855. LRR_8. 1 hit.
PF01462. LRRNT. 1 hit.
PF07714. Pkinase_Tyr. 2 hits.
PF16920. TPKR_C2. 1 hit.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
SSF52058. SSF52058. 1 hit.
SSF56112. SSF56112. 2 hits.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNTRK3_RAT
AccessioniPrimary (citable) accession number: Q03351
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: February 1, 1994
Last modified: November 30, 2016
This is version 170 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.