Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peroxisome proliferator-activated receptor delta

Gene

PPARD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi71 – 145Nuclear receptorPROSITE-ProRule annotationAdd BLAST75
Zinc fingeri74 – 94NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri111 – 133NR C4-typePROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

  • DNA binding Source: UniProtKB
  • drug binding Source: UniProtKB
  • linoleic acid binding Source: UniProtKB
  • lipid binding Source: UniProtKB
  • RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding Source: UniProtKB
  • sequence-specific DNA binding Source: InterPro
  • steroid hormone receptor activity Source: ProtInc
  • transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding Source: BHF-UCL
  • transcription coactivator activity Source: Ensembl
  • transcription factor activity, sequence-specific DNA binding Source: UniProtKB
  • transcription factor binding Source: UniProtKB
  • zinc ion binding Source: InterPro

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator, Receptor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000112033-MONOMER.
ReactomeiR-HSA-200425. Import of palmitoyl-CoA into the mitochondrial matrix.
R-HSA-204174. Regulation of pyruvate dehydrogenase (PDH) complex.
R-HSA-383280. Nuclear Receptor transcription pathway.
R-HSA-5362517. Signaling by Retinoic Acid.
SignaLinkiQ03181.
SIGNORiQ03181.

Names & Taxonomyi

Protein namesi
Recommended name:
Peroxisome proliferator-activated receptor delta
Short name:
PPAR-delta
Alternative name(s):
NUCI
Nuclear hormone receptor 1
Short name:
NUC1
Nuclear receptor subfamily 1 group C member 2
Peroxisome proliferator-activated receptor beta
Short name:
PPAR-beta
Gene namesi
Name:PPARD
Synonyms:NR1C2, PPARB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:9235. PPARD.

Subcellular locationi

GO - Cellular componenti

  • nuclear chromatin Source: BHF-UCL
  • nucleoplasm Source: Reactome
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi5467.
OpenTargetsiENSG00000112033.
PharmGKBiPA33557.

Chemistry databases

ChEMBLiCHEMBL3979.
DrugBankiDB01393. Bezafibrate.
DB00159. Icosapent.
DB00605. Sulindac.
DB00374. Treprostinil.
GuidetoPHARMACOLOGYi594.

Polymorphism and mutation databases

BioMutaiPPARD.
DMDMi417522.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000534861 – 441Peroxisome proliferator-activated receptor deltaAdd BLAST441

Proteomic databases

EPDiQ03181.
MaxQBiQ03181.
PaxDbiQ03181.
PeptideAtlasiQ03181.
PRIDEiQ03181.

PTM databases

iPTMnetiQ03181.
PhosphoSitePlusiQ03181.

Expressioni

Tissue specificityi

Ubiquitous with maximal levels in placenta and skeletal muscle.

Gene expression databases

BgeeiENSG00000112033.
CleanExiHS_PPARD.
ExpressionAtlasiQ03181. baseline and differential.
GenevisibleiQ03181. HS.

Organism-specific databases

HPAiCAB017635.

Interactioni

Subunit structurei

Heterodimer with the retinoid X receptor.6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
KDM1AO603412EBI-6426768,EBI-710124
KRTAP10-7P604093EBI-10223258,EBI-10172290

GO - Molecular functioni

  • transcription factor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi111463. 47 interactors.
IntActiQ03181. 7 interactors.
MINTiMINT-1200178.
STRINGi9606.ENSP00000310928.

Chemistry databases

BindingDBiQ03181.

Structurei

Secondary structure

1441
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi75 – 77Combined sources3
Beta strandi83 – 85Combined sources3
Beta strandi88 – 90Combined sources3
Helixi92 – 103Combined sources12
Beta strandi122 – 124Combined sources3
Helixi127 – 136Combined sources10
Helixi172 – 189Combined sources18
Helixi194 – 201Combined sources8
Beta strandi205 – 207Combined sources3
Beta strandi211 – 213Combined sources3
Helixi216 – 225Combined sources10
Beta strandi229 – 231Combined sources3
Helixi232 – 234Combined sources3
Beta strandi235 – 238Combined sources4
Helixi241 – 265Combined sources25
Turni268 – 272Combined sources5
Helixi275 – 294Combined sources20
Helixi295 – 297Combined sources3
Beta strandi302 – 305Combined sources4
Helixi306 – 308Combined sources3
Beta strandi310 – 313Combined sources4
Helixi314 – 318Combined sources5
Turni322 – 324Combined sources3
Helixi325 – 339Combined sources15
Helixi345 – 356Combined sources12
Helixi367 – 388Combined sources22
Helixi395 – 423Combined sources29
Turni424 – 426Combined sources3
Helixi431 – 438Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1GWXX-ray2.50A/B171-441[»]
1Y0SX-ray2.65A/B170-441[»]
2AWHX-ray2.00A/B174-441[»]
2B50X-ray2.00A/B169-440[»]
2BAWX-ray2.30A/B175-441[»]
2ENVNMR-A72-146[»]
2GWXX-ray2.30A/B175-441[»]
2J14X-ray2.80A/B165-441[»]
2Q5GX-ray2.70A/B165-441[»]
2XYJX-ray2.30A/B165-441[»]
2XYWX-ray3.14A/B165-441[»]
2XYXX-ray2.70A/B165-441[»]
2ZNPX-ray3.00A/B170-441[»]
2ZNQX-ray2.65A/B170-441[»]
3D5FX-ray2.20A/B175-441[»]
3DY6X-ray2.90A/B171-441[»]
3ET2X-ray2.24A/B165-441[»]
3GWXX-ray2.40A/B171-441[»]
3GZ9X-ray2.00A171-439[»]
3OZ0X-ray3.00A165-441[»]
3PEQX-ray2.40A/B171-441[»]
3SP9X-ray2.30A/B173-441[»]
3TKMX-ray1.95A171-441[»]
ProteinModelPortaliQ03181.
SMRiQ03181.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ03181.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni254 – 441Ligand-bindingAdd BLAST188

Sequence similaritiesi

Contains 1 nuclear receptor DNA-binding domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri74 – 94NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri111 – 133NR C4-typePROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG3575. Eukaryota.
ENOG410XRZC. LUCA.
GeneTreeiENSGT00850000132242.
HOGENOMiHOG000261626.
HOVERGENiHBG106004.
InParanoidiQ03181.
KOiK04504.
OMAiHDMDTLW.
OrthoDBiEOG091G05U8.
PhylomeDBiQ03181.
TreeFamiTF316304.

Family and domain databases

Gene3Di1.10.565.10. 2 hits.
3.30.50.10. 1 hit.
InterProiIPR003074. 1Cnucl_rcpt.
IPR003075. 1Cnucl_rcpt_B.
IPR000536. Nucl_hrmn_rcpt_lig-bd.
IPR001723. Nuclear_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR01288. PROXISOMEPAR.
PR01290. PROXISOMPABR.
PR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q03181-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEQPQEEAPE VREEEEKEEV AEAEGAPELN GGPQHALPSS SYTDLSRSSS
60 70 80 90 100
PPSLLDQLQM GCDGASCGSL NMECRVCGDK ASGFHYGVHA CEGCKGFFRR
110 120 130 140 150
TIRMKLEYEK CERSCKIQKK NRNKCQYCRF QKCLALGMSH NAIRFGRMPE
160 170 180 190 200
AEKRKLVAGL TANEGSQYNP QVADLKAFSK HIYNAYLKNF NMTKKKARSI
210 220 230 240 250
LTGKASHTAP FVIHDIETLW QAEKGLVWKQ LVNGLPPYKE ISVHVFYRCQ
260 270 280 290 300
CTTVETVREL TEFAKSIPSF SSLFLNDQVT LLKYGVHEAI FAMLASIVNK
310 320 330 340 350
DGLLVANGSG FVTREFLRSL RKPFSDIIEP KFEFAVKFNA LELDDSDLAL
360 370 380 390 400
FIAAIILCGD RPGLMNVPRV EAIQDTILRA LEFHLQANHP DAQYLFPKLL
410 420 430 440
QKMADLRQLV TEHAQMMQRI KKTETETSLH PLLQEIYKDM Y
Length:441
Mass (Da):49,903
Last modified:October 1, 1993 - v1
Checksum:i94FBB2A4B46521E8
GO
Isoform 2 (identifier: Q03181-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-361: DR → GE
     362-441: Missing.

Show »
Length:361
Mass (Da):40,406
Checksum:iF97757AC266EF8BA
GO
Isoform 3 (identifier: Q03181-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-43: EQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYT → HQR

Show »
Length:402
Mass (Da):45,764
Checksum:i52A73C33151BCF8A
GO
Isoform 4 (identifier: Q03181-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     44-141: Missing.

Note: No experimental confirmation available.
Show »
Length:343
Mass (Da):38,855
Checksum:i54FB19E6FCE3B21D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti79D → G in BAF84350 (PubMed:14702039).Curated1
Sequence conflicti134L → P in BAH02282 (PubMed:18619963).Curated1
Sequence conflicti191N → D in BAG65615 (PubMed:14702039).Curated1
Sequence conflicti217E → K in BAG65615 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0437872 – 43EQPQE…SSSYT → HQR in isoform 3. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_04610444 – 141Missing in isoform 4. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_010133360 – 361DR → GE in isoform 2. 1 Publication2
Alternative sequenceiVSP_010134362 – 441Missing in isoform 2. 1 PublicationAdd BLAST80

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L07592 mRNA. Translation: AAA36469.1.
AF246303
, AF246299, AF246300, AF246301, AF246302 Genomic DNA. Translation: AAF62553.1.
AB307691 mRNA. Translation: BAH02282.1.
AY919140 mRNA. Translation: AAX14041.1.
AK291661 mRNA. Translation: BAF84350.1.
AK296425 mRNA. Translation: BAH12347.1.
AK304878 mRNA. Translation: BAG65615.1.
AK122614 mRNA. Translation: BAG53624.1.
AY442342 Genomic DNA. Translation: AAR05439.1.
AL022721 Genomic DNA. Translation: CAB38629.1.
AL022721 Genomic DNA. Translation: CAD92505.1.
CH471081 Genomic DNA. Translation: EAX03825.1.
BC002715 mRNA. Translation: AAH02715.1.
BC007578 mRNA. Translation: AAH07578.1.
AB099507 mRNA. Translation: BAC78903.1.
CCDSiCCDS4803.1. [Q03181-1]
CCDS4804.1. [Q03181-2]
CCDS54994.1. [Q03181-3]
CCDS54995.1. [Q03181-4]
PIRiA45360.
RefSeqiNP_001165289.1. NM_001171818.1.
NP_001165290.1. NM_001171819.1. [Q03181-3]
NP_001165291.1. NM_001171820.1. [Q03181-4]
NP_006229.1. NM_006238.4. [Q03181-1]
NP_803184.1. NM_177435.2. [Q03181-2]
XP_005249250.1. XM_005249193.1. [Q03181-1]
XP_006715183.1. XM_006715120.1. [Q03181-1]
XP_006715186.1. XM_006715123.1. [Q03181-1]
XP_011513009.1. XM_011514707.1. [Q03181-1]
XP_011513011.1. XM_011514709.1. [Q03181-1]
XP_011513012.1. XM_011514710.1. [Q03181-1]
XP_016866460.1. XM_017010971.1. [Q03181-1]
XP_016866461.1. XM_017010972.1. [Q03181-1]
XP_016866462.1. XM_017010973.1. [Q03181-1]
XP_016866463.1. XM_017010974.1. [Q03181-1]
UniGeneiHs.696032.

Genome annotation databases

EnsembliENST00000311565; ENSP00000310928; ENSG00000112033. [Q03181-1]
ENST00000337400; ENSP00000337063; ENSG00000112033. [Q03181-2]
ENST00000360694; ENSP00000353916; ENSG00000112033. [Q03181-1]
ENST00000418635; ENSP00000413314; ENSG00000112033. [Q03181-4]
ENST00000448077; ENSP00000414372; ENSG00000112033. [Q03181-3]
GeneIDi5467.
KEGGihsa:5467.
UCSCiuc003okm.3. human. [Q03181-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

NIEHS-SNPs
Wikipedia

Peroxisome proliferator-activated receptor entry

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L07592 mRNA. Translation: AAA36469.1.
AF246303
, AF246299, AF246300, AF246301, AF246302 Genomic DNA. Translation: AAF62553.1.
AB307691 mRNA. Translation: BAH02282.1.
AY919140 mRNA. Translation: AAX14041.1.
AK291661 mRNA. Translation: BAF84350.1.
AK296425 mRNA. Translation: BAH12347.1.
AK304878 mRNA. Translation: BAG65615.1.
AK122614 mRNA. Translation: BAG53624.1.
AY442342 Genomic DNA. Translation: AAR05439.1.
AL022721 Genomic DNA. Translation: CAB38629.1.
AL022721 Genomic DNA. Translation: CAD92505.1.
CH471081 Genomic DNA. Translation: EAX03825.1.
BC002715 mRNA. Translation: AAH02715.1.
BC007578 mRNA. Translation: AAH07578.1.
AB099507 mRNA. Translation: BAC78903.1.
CCDSiCCDS4803.1. [Q03181-1]
CCDS4804.1. [Q03181-2]
CCDS54994.1. [Q03181-3]
CCDS54995.1. [Q03181-4]
PIRiA45360.
RefSeqiNP_001165289.1. NM_001171818.1.
NP_001165290.1. NM_001171819.1. [Q03181-3]
NP_001165291.1. NM_001171820.1. [Q03181-4]
NP_006229.1. NM_006238.4. [Q03181-1]
NP_803184.1. NM_177435.2. [Q03181-2]
XP_005249250.1. XM_005249193.1. [Q03181-1]
XP_006715183.1. XM_006715120.1. [Q03181-1]
XP_006715186.1. XM_006715123.1. [Q03181-1]
XP_011513009.1. XM_011514707.1. [Q03181-1]
XP_011513011.1. XM_011514709.1. [Q03181-1]
XP_011513012.1. XM_011514710.1. [Q03181-1]
XP_016866460.1. XM_017010971.1. [Q03181-1]
XP_016866461.1. XM_017010972.1. [Q03181-1]
XP_016866462.1. XM_017010973.1. [Q03181-1]
XP_016866463.1. XM_017010974.1. [Q03181-1]
UniGeneiHs.696032.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1GWXX-ray2.50A/B171-441[»]
1Y0SX-ray2.65A/B170-441[»]
2AWHX-ray2.00A/B174-441[»]
2B50X-ray2.00A/B169-440[»]
2BAWX-ray2.30A/B175-441[»]
2ENVNMR-A72-146[»]
2GWXX-ray2.30A/B175-441[»]
2J14X-ray2.80A/B165-441[»]
2Q5GX-ray2.70A/B165-441[»]
2XYJX-ray2.30A/B165-441[»]
2XYWX-ray3.14A/B165-441[»]
2XYXX-ray2.70A/B165-441[»]
2ZNPX-ray3.00A/B170-441[»]
2ZNQX-ray2.65A/B170-441[»]
3D5FX-ray2.20A/B175-441[»]
3DY6X-ray2.90A/B171-441[»]
3ET2X-ray2.24A/B165-441[»]
3GWXX-ray2.40A/B171-441[»]
3GZ9X-ray2.00A171-439[»]
3OZ0X-ray3.00A165-441[»]
3PEQX-ray2.40A/B171-441[»]
3SP9X-ray2.30A/B173-441[»]
3TKMX-ray1.95A171-441[»]
ProteinModelPortaliQ03181.
SMRiQ03181.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111463. 47 interactors.
IntActiQ03181. 7 interactors.
MINTiMINT-1200178.
STRINGi9606.ENSP00000310928.

Chemistry databases

BindingDBiQ03181.
ChEMBLiCHEMBL3979.
DrugBankiDB01393. Bezafibrate.
DB00159. Icosapent.
DB00605. Sulindac.
DB00374. Treprostinil.
GuidetoPHARMACOLOGYi594.

PTM databases

iPTMnetiQ03181.
PhosphoSitePlusiQ03181.

Polymorphism and mutation databases

BioMutaiPPARD.
DMDMi417522.

Proteomic databases

EPDiQ03181.
MaxQBiQ03181.
PaxDbiQ03181.
PeptideAtlasiQ03181.
PRIDEiQ03181.

Protocols and materials databases

DNASUi5467.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311565; ENSP00000310928; ENSG00000112033. [Q03181-1]
ENST00000337400; ENSP00000337063; ENSG00000112033. [Q03181-2]
ENST00000360694; ENSP00000353916; ENSG00000112033. [Q03181-1]
ENST00000418635; ENSP00000413314; ENSG00000112033. [Q03181-4]
ENST00000448077; ENSP00000414372; ENSG00000112033. [Q03181-3]
GeneIDi5467.
KEGGihsa:5467.
UCSCiuc003okm.3. human. [Q03181-1]

Organism-specific databases

CTDi5467.
DisGeNETi5467.
GeneCardsiPPARD.
H-InvDBHIX0165038.
HGNCiHGNC:9235. PPARD.
HPAiCAB017635.
MIMi600409. gene.
neXtProtiNX_Q03181.
OpenTargetsiENSG00000112033.
PharmGKBiPA33557.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3575. Eukaryota.
ENOG410XRZC. LUCA.
GeneTreeiENSGT00850000132242.
HOGENOMiHOG000261626.
HOVERGENiHBG106004.
InParanoidiQ03181.
KOiK04504.
OMAiHDMDTLW.
OrthoDBiEOG091G05U8.
PhylomeDBiQ03181.
TreeFamiTF316304.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000112033-MONOMER.
ReactomeiR-HSA-200425. Import of palmitoyl-CoA into the mitochondrial matrix.
R-HSA-204174. Regulation of pyruvate dehydrogenase (PDH) complex.
R-HSA-383280. Nuclear Receptor transcription pathway.
R-HSA-5362517. Signaling by Retinoic Acid.
SignaLinkiQ03181.
SIGNORiQ03181.

Miscellaneous databases

ChiTaRSiPPARD. human.
EvolutionaryTraceiQ03181.
GeneWikiiPeroxisome_proliferator-activated_receptor_delta.
GenomeRNAii5467.
PROiQ03181.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000112033.
CleanExiHS_PPARD.
ExpressionAtlasiQ03181. baseline and differential.
GenevisibleiQ03181. HS.

Family and domain databases

Gene3Di1.10.565.10. 2 hits.
3.30.50.10. 1 hit.
InterProiIPR003074. 1Cnucl_rcpt.
IPR003075. 1Cnucl_rcpt_B.
IPR000536. Nucl_hrmn_rcpt_lig-bd.
IPR001723. Nuclear_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR01288. PROXISOMEPAR.
PR01290. PROXISOMPABR.
PR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPPARD_HUMAN
AccessioniPrimary (citable) accession number: Q03181
Secondary accession number(s): A8K6J6
, B4E3V3, B6ZGS1, B7Z3W1, E9PE18, Q5D1P0, Q7Z5K0, Q9BUD4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: November 2, 2016
This is version 201 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.