Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MDS1 and EVI1 complex locus protein EVI1

Gene

MECOM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as a transcriptional regulator binding to DNA sequences in the promoter region of target genes and regulating positively or negatively their expression. Oncogene which plays a role in development, cell proliferation and differentiation. May also play a role in apoptosis through regulation of the JNK and TGF-beta signaling. Involved in hematopoiesis.6 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri21 – 44C2H2-type 1PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri75 – 97C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri103 – 125C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri131 – 154C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri160 – 182C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri188 – 210C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri217 – 239C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri733 – 755C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri761 – 784C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri790 – 812C2H2-type 10PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

  • apoptotic process Source: UniProtKB-KW
  • cell differentiation Source: UniProtKB-KW
  • hematopoietic stem cell proliferation Source: UniProtKB
  • negative regulation of JNK cascade Source: UniProtKB
  • negative regulation of programmed cell death Source: UniProtKB
  • negative regulation of transcription, DNA-templated Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • regulation of cell cycle Source: UniProtKB
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Apoptosis, Differentiation, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000085276-MONOMER.
ReactomeiR-HSA-3214841. PKMTs methylate histone lysines.
SignaLinkiQ03112.
SIGNORiQ03112.

Names & Taxonomyi

Protein namesi
Recommended name:
MDS1 and EVI1 complex locus protein EVI1
Alternative name(s):
Ecotropic virus integration site 1 protein homolog
Short name:
EVI-1
Gene namesi
Name:MECOM
Synonyms:EVI1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:3498. MECOM.

Subcellular locationi

GO - Cellular componenti

  • aggresome Source: HPA
  • cytoplasm Source: HPA
  • cytosol Source: Reactome
  • Golgi apparatus Source: HPA
  • intracellular membrane-bounded organelle Source: HPA
  • nuclear speck Source: UniProtKB
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving EVI1 is a cause of chronic myelogenous leukemia (CML). Translocation t(3;21)(q26;q22) with RUNX1/AML1.

Radioulnar synostosis with amegakaryocytic thrombocytopenia 2 (RUSAT2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant disease characterized by proximal fusion of the radius and ulna resulting in extremely limited pronation and supination of the forearm, and congenital thrombocytopenia that progresses to pancytopenia.
See also OMIM:616738
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_076308750R → W in RUSAT2; alters transcriptional regulation. 1 Publication1
Natural variantiVAR_076309751H → R in RUSAT2; alters transcriptional regulation. 1 Publication1
Natural variantiVAR_076310756T → A in RUSAT2; alters transcriptional regulation. 1 Publication1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi555 – 556DL → AS: Partial loss of interaction with CTBP1. Loss of interaction with CTBP1; when associated with 586-A-S-587. 1 Publication2
Mutagenesisi586 – 587DL → AS: Partial loss of interaction with CTBP1. Loss of interaction with CTBP1; when associated with 555-A-S-556. 1 Publication2

Keywords - Diseasei

Disease mutation, Proto-oncogene

Organism-specific databases

DisGeNETi2122.
MalaCardsiMECOM.
MIMi616738. phenotype.
OpenTargetsiENSG00000085276.
Orphaneti402020. 'Acute myeloid leukemia with inv3(p21;q26.2) or t(3;3)(p21;q26.2)'.
52688. Myelodysplastic syndrome.
PharmGKBiPA27912.

Polymorphism and mutation databases

BioMutaiARHGAP32.
DMDMi145559472.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000472731 – 1051MDS1 and EVI1 complex locus protein EVI1Add BLAST1051

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki2Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki367Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei436PhosphoserineCombined sources1
Cross-linki497Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki533Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei538PhosphoserineCombined sources1
Cross-linki547Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei552PhosphoserineBy similarity1
Cross-linki564Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki599Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki698Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei858PhosphoserineCombined sources1
Modified residuei860PhosphoserineCombined sources1
Cross-linki874Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki948Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki953Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki973Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 4 (identifier: Q03112-4)
Cross-linki66Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 2 (identifier: Q03112-3)
Cross-linki190Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Post-translational modificationi

Phosphorylated.By similarity
May be acetylated by CREBBP and KAT2B.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ03112.
PeptideAtlasiQ03112.
PRIDEiQ03112.

PTM databases

iPTMnetiQ03112.
PhosphoSitePlusiQ03112.

Expressioni

Gene expression databases

BgeeiENSG00000085276.
CleanExiHS_EVI1.
ExpressionAtlasiQ03112. baseline and differential.
GenevisibleiQ03112. HS.

Organism-specific databases

HPAiHPA046537.
HPA052977.

Interactioni

Subunit structurei

Homooligomer. Interacts with SUV39H1 (via SET domain); enhances MECOM transcriptional repression activity (By similarity). Interacts with CTBP1. Interacts with SMAD3 (via MH2 domain); the interaction is direct. Interacts with SMAD4; through interaction with SMAD3. Interacts with CREBBP, KAT2B and histone deacetylases. Interacts with MAPK8 and MAPK9; inhibits JNK signaling.By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Ctbp2P565463EBI-1384862,EBI-1384883From a different organism.
SIRT1Q96EB62EBI-1384862,EBI-1802965
UXTQ9UBK95EBI-1384862,EBI-357355

GO - Molecular functioni

  • protein homodimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi108423. 27 interactors.
DIPiDIP-38639N.
IntActiQ03112. 4 interactors.
STRINGi9606.ENSP00000264674.

Structurei

3D structure databases

ProteinModelPortaliQ03112.
SMRiQ03112.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 252Interaction with MAPK9, SMAD3 and probably SUV39H11 PublicationAdd BLAST252

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi421 – 434Nuclear localization signalSequence analysisAdd BLAST14
Motifi553 – 557CTBP-binding motif 1By similarity5
Motifi584 – 588CTBP-binding motif 2By similarity5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi886 – 937Asp/Glu-rich (acidic)Add BLAST52

Domaini

Both zinc finger regions are required for the transcriptional activation of PBX1.

Sequence similaritiesi

Contains 10 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri21 – 44C2H2-type 1PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri75 – 97C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri103 – 125C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri131 – 154C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri160 – 182C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri188 – 210C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri217 – 239C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri733 – 755C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri761 – 784C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri790 – 812C2H2-type 10PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063676.
HOVERGENiHBG005619.
InParanoidiQ03112.
KOiK04462.
PhylomeDBiQ03112.
TreeFamiTF315309.

Family and domain databases

Gene3Di3.30.160.60. 9 hits.
InterProiIPR030413. Evi1/Prdm16.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PANTHERiPTHR24393. PTHR24393. 1 hit.
PfamiPF00096. zf-C2H2. 3 hits.
PF13912. zf-C2H2_6. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 10 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 10 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q03112-1) [UniParc]FASTAAdd to basket
Also known as: Long, Evi-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKSEDYPHET MAPDIHEERQ YRCEDCDQLF ESKAELADHQ KFPCSTPHSA
60 70 80 90 100
FSMVEEDFQQ KLESENDLQE IHTIQECKEC DQVFPDLQSL EKHMLSHTEE
110 120 130 140 150
REYKCDQCPK AFNWKSNLIR HQMSHDSGKH YECENCAKVF TDPSNLQRHI
160 170 180 190 200
RSQHVGARAH ACPECGKTFA TSSGLKQHKH IHSSVKPFIC EVCHKSYTQF
210 220 230 240 250
SNLCRHKRMH ADCRTQIKCK DCGQMFSTTS SLNKHRRFCE GKNHFAAGGF
260 270 280 290 300
FGQGISLPGT PAMDKTSMVN MSHANPGLAD YFGANRHPAG LTFPTAPGFS
310 320 330 340 350
FSFPGLFPSG LYHRPPLIPA SSPVKGLSST EQTNKSQSPL MTHPQILPAT
360 370 380 390 400
QDILKALSKH PSVGDNKPVE LQPERSSEER PFEKISDQSE SSDLDDVSTP
410 420 430 440 450
SGSDLETTSG SDLESDIESD KEKFKENGKM FKDKVSPLQN LASINNKKEY
460 470 480 490 500
SNHSIFSPSL EEQTAVSGAV NDSIKAIASI AEKYFGSTGL VGLQDKKVGA
510 520 530 540 550
LPYPSMFPLP FFPAFSQSMY PFPDRDLRSL PLKMEPQSPG EVKKLQKGSS
560 570 580 590 600
ESPFDLTTKR KDEKPLTPVP SKPPVTPATS QDQPLDLSMG SRSRASGTKL
610 620 630 640 650
TEPRKNHVFG GKKGSNVESR PASDGSLQHA RPTPFFMDPI YRVEKRKLTD
660 670 680 690 700
PLEALKEKYL RPSPGFLFHP QFQLPDQRTW MSAIENMAEK LESFSALKPE
710 720 730 740 750
ASELLQSVPS MFNFRAPPNA LPENLLRKGK ERYTCRYCGK IFPRSANLTR
760 770 780 790 800
HLRTHTGEQP YRCKYCDRSF SISSNLQRHV RNIHNKEKPF KCHLCDRCFG
810 820 830 840 850
QQTNLDRHLK KHENGNMSGT ATSSPHSELE STGAILDDKE DAYFTEIRNF
860 870 880 890 900
IGNSNHGSQS PRNVEERMNG SHFKDEKALV TSQNSDLLDD EEVEDEVLLD
910 920 930 940 950
EEDEDNDITG KTGKEPVTSN LHEGNPEDDY EETSALEMSC KTSPVRYKEE
960 970 980 990 1000
EYKSGLSALD HIRHFTDSLK MRKMEDNQYS EAELSSFSTS HVPEELKQPL
1010 1020 1030 1040 1050
HRKSKSQAYA MMLSLSDKES LHSTSHSSSN VWHSMARAAA ESSAIQSISH

V
Length:1,051
Mass (Da):118,276
Last modified:April 17, 2007 - v2
Checksum:iBD132C53EA08D263
GO
Isoform 2 (identifier: Q03112-3) [UniParc]FASTAAdd to basket
Also known as: Evi-1c, Mds1/Evi1

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRSKGRARKL...APGEELLLFM

Note: Produced by alternative promoter usage. Contains an additional SET domain at positions 79-194. Unable to form homooligomers, to interact with CTBP1 and SMAD3 and to repress TGF-beta signaling.Combined sources
Show »
Length:1,239
Mass (Da):139,308
Checksum:iE8A5EAD310102D53
GO
Isoform 3 (identifier: Q13465-1) [UniParc]FASTAAdd to basket
Also known as: Mds1
The sequence of this isoform can be found in the external entry Q13465.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage.
Length:169
Mass (Da):18,696
GO
Isoform 4 (identifier: Q03112-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFM
     138-138: K → KQ

Show »
Length:1,116
Mass (Da):125,807
Checksum:i772D3F793270B394
GO
Isoform 5 (identifier: Q03112-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     672-680: Missing.

Show »
Length:1,042
Mass (Da):117,104
Checksum:i97476C1D04DB2007
GO
Isoform 6 (identifier: Q03112-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     138-138: K → KQ
     672-680: Missing.

Show »
Length:1,043
Mass (Da):117,232
Checksum:iB6A0605E499FF208
GO

Sequence cautioni

The sequence AAB29907 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAB37456 differs from that shown. Probable cloning artifact.Curated
The sequence AAI30521 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAH14103 differs from that shown. Aberrant splicing.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti20Q → R in CAE45952 (PubMed:17974005).Curated1
Sequence conflicti175L → P in CAE45952 (PubMed:17974005).Curated1
Sequence conflicti301F → S in BAF85554 (PubMed:14702039).Curated1
Sequence conflicti303F → V in CAA38735 (PubMed:2115646).Curated1
Sequence conflicti443S → P in CAI46086 (PubMed:17974005).Curated1
Sequence conflicti543K → R in CAE45952 (PubMed:17974005).Curated1
Sequence conflicti730K → R in BAF85554 (PubMed:14702039).Curated1
Sequence conflicti741I → V in CAI46086 (PubMed:17974005).Curated1
Sequence conflicti796D → Y in CAA38735 (PubMed:2115646).Curated1
Sequence conflicti875D → E in CAA38735 (PubMed:2115646).Curated1
Sequence conflicti881T → P in CAA38735 (PubMed:2115646).Curated1
Sequence conflicti906N → Y in CAA38735 (PubMed:2115646).Curated1
Sequence conflicti992V → A in BAF85554 (PubMed:14702039).Curated1
Sequence conflicti1013L → P in CAE45952 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061928107Q → R.Corresponds to variant rs34896995dbSNPEnsembl.1
Natural variantiVAR_076308750R → W in RUSAT2; alters transcriptional regulation. 1 Publication1
Natural variantiVAR_076309751H → R in RUSAT2; alters transcriptional regulation. 1 Publication1
Natural variantiVAR_076310756T → A in RUSAT2; alters transcriptional regulation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0387331M → MRSKGRARKLATNNECVYGN YPEIPLEEMPDADGVASTPS LNIQEPCSPATSSEAFTPKE GSPYKAPIYIPDDIPIPAEF ELRESNMPGAGLGIWTKRKI EVGEKFGPYVGEQRSNLKDP SYGWEILDEFYNVKFCIDAS QPDVGSWLKYIRFAGCYDQH NLVACQINDQIFYRVVADIA PGEELLLFM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0387341M → MILDEFYNVKFCIDASQPDV GSWLKYIRFAGCYDQHNLVA CQINDQIFYRVVADIAPGEE LLLFM in isoform 4. 1 Publication1
Alternative sequenceiVSP_038735138K → KQ in isoform 4 and isoform 6. 1 Publication1
Alternative sequenceiVSP_038736672 – 680Missing in isoform 5 and isoform 6. 3 Publications9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X54989 mRNA. Translation: CAA38735.1.
S69002 mRNA. Translation: AAB29907.1. Different initiation.
AK292865 mRNA. Translation: BAF85554.1.
AK304098 mRNA. Translation: BAH14103.1. Sequence problems.
BX640908 mRNA. Translation: CAE45952.1.
BX647613 mRNA. Translation: CAI46086.1.
AC007849 Genomic DNA. No translation available.
AC024099 Genomic DNA. No translation available.
AC069220 Genomic DNA. No translation available.
AC074033 Genomic DNA. No translation available.
AC078985 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78553.1.
CH471052 Genomic DNA. Translation: EAW78556.1.
CH471052 Genomic DNA. Translation: EAW78557.1.
BC031019 mRNA. Translation: AAH31019.1.
BC130520 mRNA. Translation: AAI30521.1. Different initiation.
BC143951 mRNA. Translation: AAI43952.1.
BC143952 mRNA. Translation: AAI43953.1.
S82592 mRNA. Translation: AAB37456.1. Sequence problems.
CCDSiCCDS3205.1. [Q03112-1]
CCDS54669.1. [Q03112-5]
CCDS54670.1. [Q03112-4]
PIRiA60191.
S41705.
RefSeqiNP_001098547.3. NM_001105077.3. [Q03112-4]
NP_001098548.2. NM_001105078.3. [Q03112-1]
NP_001157471.1. NM_001163999.1. [Q03112-6]
NP_001157472.1. NM_001164000.1. [Q03112-5]
NP_001192123.1. NM_001205194.1. [Q03112-1]
NP_004982.2. NM_004991.3. [Q03112-3]
NP_005232.2. NM_005241.3. [Q03112-1]
XP_005247276.1. XM_005247219.2.
XP_005247277.1. XM_005247220.2.
XP_005247278.1. XM_005247221.2.
XP_005247280.1. XM_005247223.2. [Q03112-1]
XP_016861363.1. XM_017005874.1. [Q03112-4]
XP_016861364.1. XM_017005875.1. [Q03112-5]
XP_016861365.1. XM_017005876.1. [Q03112-6]
UniGeneiHs.744090.

Genome annotation databases

EnsembliENST00000264674; ENSP00000264674; ENSG00000085276. [Q03112-4]
ENST00000464456; ENSP00000419770; ENSG00000085276. [Q03112-5]
ENST00000468789; ENSP00000419995; ENSG00000085276. [Q03112-1]
ENST00000628990; ENSP00000486104; ENSG00000085276. [Q03112-1]
GeneIDi2122.
KEGGihsa:2122.
UCSCiuc003ffi.3. human. [Q03112-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X54989 mRNA. Translation: CAA38735.1.
S69002 mRNA. Translation: AAB29907.1. Different initiation.
AK292865 mRNA. Translation: BAF85554.1.
AK304098 mRNA. Translation: BAH14103.1. Sequence problems.
BX640908 mRNA. Translation: CAE45952.1.
BX647613 mRNA. Translation: CAI46086.1.
AC007849 Genomic DNA. No translation available.
AC024099 Genomic DNA. No translation available.
AC069220 Genomic DNA. No translation available.
AC074033 Genomic DNA. No translation available.
AC078985 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78553.1.
CH471052 Genomic DNA. Translation: EAW78556.1.
CH471052 Genomic DNA. Translation: EAW78557.1.
BC031019 mRNA. Translation: AAH31019.1.
BC130520 mRNA. Translation: AAI30521.1. Different initiation.
BC143951 mRNA. Translation: AAI43952.1.
BC143952 mRNA. Translation: AAI43953.1.
S82592 mRNA. Translation: AAB37456.1. Sequence problems.
CCDSiCCDS3205.1. [Q03112-1]
CCDS54669.1. [Q03112-5]
CCDS54670.1. [Q03112-4]
PIRiA60191.
S41705.
RefSeqiNP_001098547.3. NM_001105077.3. [Q03112-4]
NP_001098548.2. NM_001105078.3. [Q03112-1]
NP_001157471.1. NM_001163999.1. [Q03112-6]
NP_001157472.1. NM_001164000.1. [Q03112-5]
NP_001192123.1. NM_001205194.1. [Q03112-1]
NP_004982.2. NM_004991.3. [Q03112-3]
NP_005232.2. NM_005241.3. [Q03112-1]
XP_005247276.1. XM_005247219.2.
XP_005247277.1. XM_005247220.2.
XP_005247278.1. XM_005247221.2.
XP_005247280.1. XM_005247223.2. [Q03112-1]
XP_016861363.1. XM_017005874.1. [Q03112-4]
XP_016861364.1. XM_017005875.1. [Q03112-5]
XP_016861365.1. XM_017005876.1. [Q03112-6]
UniGeneiHs.744090.

3D structure databases

ProteinModelPortaliQ03112.
SMRiQ03112.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108423. 27 interactors.
DIPiDIP-38639N.
IntActiQ03112. 4 interactors.
STRINGi9606.ENSP00000264674.

PTM databases

iPTMnetiQ03112.
PhosphoSitePlusiQ03112.

Polymorphism and mutation databases

BioMutaiARHGAP32.
DMDMi145559472.

Proteomic databases

PaxDbiQ03112.
PeptideAtlasiQ03112.
PRIDEiQ03112.

Protocols and materials databases

DNASUi2122.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264674; ENSP00000264674; ENSG00000085276. [Q03112-4]
ENST00000464456; ENSP00000419770; ENSG00000085276. [Q03112-5]
ENST00000468789; ENSP00000419995; ENSG00000085276. [Q03112-1]
ENST00000628990; ENSP00000486104; ENSG00000085276. [Q03112-1]
GeneIDi2122.
KEGGihsa:2122.
UCSCiuc003ffi.3. human. [Q03112-1]

Organism-specific databases

CTDi2122.
DisGeNETi2122.
GeneCardsiMECOM.
H-InvDBHIX0003836.
HGNCiHGNC:3498. MECOM.
HPAiHPA046537.
HPA052977.
MalaCardsiMECOM.
MIMi165215. gene.
616738. phenotype.
neXtProtiNX_Q03112.
OpenTargetsiENSG00000085276.
Orphaneti402020. 'Acute myeloid leukemia with inv3(p21;q26.2) or t(3;3)(p21;q26.2)'.
52688. Myelodysplastic syndrome.
PharmGKBiPA27912.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063676.
HOVERGENiHBG005619.
InParanoidiQ03112.
KOiK04462.
PhylomeDBiQ03112.
TreeFamiTF315309.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000085276-MONOMER.
ReactomeiR-HSA-3214841. PKMTs methylate histone lysines.
SignaLinkiQ03112.
SIGNORiQ03112.

Miscellaneous databases

ChiTaRSiMECOM. human.
GeneWikiiMECOM.
GenomeRNAii2122.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000085276.
CleanExiHS_EVI1.
ExpressionAtlasiQ03112. baseline and differential.
GenevisibleiQ03112. HS.

Family and domain databases

Gene3Di3.30.160.60. 9 hits.
InterProiIPR030413. Evi1/Prdm16.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PANTHERiPTHR24393. PTHR24393. 1 hit.
PfamiPF00096. zf-C2H2. 3 hits.
PF13912. zf-C2H2_6. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 10 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 10 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiEVI1_HUMAN
AccessioniPrimary (citable) accession number: Q03112
Secondary accession number(s): A1L4F3
, A8KA00, B7Z8W7, B7ZLQ3, B7ZLQ4, C9JAK0, D3DNP7, Q16122, Q5HYI1, Q6MZS6, Q8NEI5, Q99917
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: April 17, 2007
Last modified: November 30, 2016
This is version 165 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.