Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q03112

- EVI1_HUMAN

UniProt

Q03112 - EVI1_HUMAN

Protein

MDS1 and EVI1 complex locus protein EVI1

Gene

MECOM

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 142 (01 Oct 2014)
      Sequence version 2 (17 Apr 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Functions as a transcriptional regulator binding to DNA sequences in the promoter region of target genes and regulating positively or negatively their expression. Oncogene which plays a role in development, cell proliferation and differentiation. May also play a role in apoptosis through regulation of the JNK and TGF-beta signaling. Involved in hematopoiesis.6 Publications

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri21 – 4424C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri75 – 9723C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri103 – 12523C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri131 – 15424C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri160 – 18223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri188 – 21023C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri217 – 23923C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri733 – 75523C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri761 – 78424C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri790 – 81223C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB
    2. metal ion binding Source: UniProtKB-KW
    3. protein binding Source: UniProtKB
    4. protein homodimerization activity Source: UniProtKB
    5. sequence-specific DNA binding transcription factor activity Source: UniProtKB

    GO - Biological processi

    1. apoptotic process Source: UniProtKB-KW
    2. cell differentiation Source: UniProtKB-KW
    3. embryonic forelimb morphogenesis Source: Ensembl
    4. embryonic hindlimb morphogenesis Source: Ensembl
    5. forebrain development Source: Ensembl
    6. hematopoietic stem cell proliferation Source: UniProtKB
    7. inflammatory response Source: Ensembl
    8. in utero embryonic development Source: Ensembl
    9. negative regulation of JNK cascade Source: UniProtKB
    10. negative regulation of programmed cell death Source: UniProtKB
    11. negative regulation of transcription, DNA-templated Source: UniProtKB
    12. neutrophil homeostasis Source: Ensembl
    13. pericardium development Source: Ensembl
    14. positive regulation of transcription, DNA-templated Source: UniProtKB
    15. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
    16. post-embryonic development Source: Ensembl
    17. regulation of cell cycle Source: UniProtKB
    18. regulation of cell proliferation Source: Ensembl
    19. renal system development Source: Ensembl
    20. response to bacterium Source: Ensembl
    21. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Apoptosis, Differentiation, Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Enzyme and pathway databases

    SignaLinkiQ03112.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    MDS1 and EVI1 complex locus protein EVI1
    Alternative name(s):
    Ecotropic virus integration site 1 protein homolog
    Short name:
    EVI-1
    Gene namesi
    Name:MECOM
    Synonyms:EVI1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:3498. MECOM.

    Subcellular locationi

    GO - Cellular componenti

    1. nuclear speck Source: UniProtKB
    2. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    A chromosomal aberration involving EVI1 is a cause of chronic myelogenous leukemia (CML). Translocation t(3;21)(q26;q22) with RUNX1/AML1.

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi555 – 5562DL → AS: Partial loss of interaction with CTBP1. Loss of interaction with CTBP1; when associated with 586-A-S-587. 1 Publication
    Mutagenesisi586 – 5872DL → AS: Partial loss of interaction with CTBP1. Loss of interaction with CTBP1; when associated with 555-A-S-556. 1 Publication

    Keywords - Diseasei

    Proto-oncogene

    Organism-specific databases

    Orphaneti52688. Myelodysplastic syndromes.
    PharmGKBiPA27912.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10511051MDS1 and EVI1 complex locus protein EVI1PRO_0000047273Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei860 – 8601Phosphoserine1 Publication

    Post-translational modificationi

    Phosphorylated.By similarity
    May be acetylated by CREBBP and KAT2B.1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ03112.
    PaxDbiQ03112.
    PRIDEiQ03112.

    PTM databases

    PhosphoSiteiQ03112.

    Expressioni

    Gene expression databases

    ArrayExpressiQ03112.
    BgeeiQ03112.
    CleanExiHS_EVI1.
    GenevestigatoriQ03112.

    Organism-specific databases

    HPAiHPA046537.

    Interactioni

    Subunit structurei

    Homooligomer. Interacts with SUV39H1 (via SET domain); enhances MECOM transcriptional repression activity By similarity. Interacts with CTBP1. Interacts with SMAD3 (via MH2 domain); the interaction is direct. Interacts with SMAD4; through interaction with SMAD3. Interacts with CREBBP, KAT2B and histone deacetylases. Interacts with MAPK8 and MAPK9; inhibits JNK signaling.By similarity4 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Ctbp2P565463EBI-1384862,EBI-1384883From a different organism.
    SIRT1Q96EB62EBI-1384862,EBI-1802965
    UXTQ9UBK95EBI-1384862,EBI-357355

    Protein-protein interaction databases

    BioGridi108423. 18 interactions.
    DIPiDIP-38639N.
    IntActiQ03112. 3 interactions.
    STRINGi9606.ENSP00000264674.

    Structurei

    3D structure databases

    ProteinModelPortaliQ03112.
    SMRiQ03112. Positions 19-237, 733-813.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 252252Interaction with MAPK9, SMAD3 and probably SUV39H1Add
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi421 – 43414Nuclear localization signalSequence AnalysisAdd
    BLAST
    Motifi553 – 5575CTBP-binding motif 1By similarity
    Motifi584 – 5885CTBP-binding motif 2By similarity

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi886 – 93752Asp/Glu-rich (acidic)Add
    BLAST

    Domaini

    Both zinc finger regions are required for the transcriptional activation of PBX1.

    Sequence similaritiesi

    Contains 10 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri21 – 4424C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri75 – 9723C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri103 – 12523C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri131 – 15424C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri160 – 18223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri188 – 21023C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri217 – 23923C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri733 – 75523C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri761 – 78424C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri790 – 81223C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOVERGENiHBG005619.
    InParanoidiQ03112.
    KOiK04462.
    OrthoDBiEOG72G16H.
    PhylomeDBiQ03112.
    TreeFamiTF315309.

    Family and domain databases

    Gene3Di3.30.160.60. 8 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF00096. zf-C2H2. 10 hits.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 10 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
    PS50157. ZINC_FINGER_C2H2_2. 10 hits.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative promoter usage and alternative splicing. Align

    Isoform 1 (identifier: Q03112-1) [UniParc]FASTAAdd to Basket

    Also known as: Long, Evi-1a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKSEDYPHET MAPDIHEERQ YRCEDCDQLF ESKAELADHQ KFPCSTPHSA     50
    FSMVEEDFQQ KLESENDLQE IHTIQECKEC DQVFPDLQSL EKHMLSHTEE 100
    REYKCDQCPK AFNWKSNLIR HQMSHDSGKH YECENCAKVF TDPSNLQRHI 150
    RSQHVGARAH ACPECGKTFA TSSGLKQHKH IHSSVKPFIC EVCHKSYTQF 200
    SNLCRHKRMH ADCRTQIKCK DCGQMFSTTS SLNKHRRFCE GKNHFAAGGF 250
    FGQGISLPGT PAMDKTSMVN MSHANPGLAD YFGANRHPAG LTFPTAPGFS 300
    FSFPGLFPSG LYHRPPLIPA SSPVKGLSST EQTNKSQSPL MTHPQILPAT 350
    QDILKALSKH PSVGDNKPVE LQPERSSEER PFEKISDQSE SSDLDDVSTP 400
    SGSDLETTSG SDLESDIESD KEKFKENGKM FKDKVSPLQN LASINNKKEY 450
    SNHSIFSPSL EEQTAVSGAV NDSIKAIASI AEKYFGSTGL VGLQDKKVGA 500
    LPYPSMFPLP FFPAFSQSMY PFPDRDLRSL PLKMEPQSPG EVKKLQKGSS 550
    ESPFDLTTKR KDEKPLTPVP SKPPVTPATS QDQPLDLSMG SRSRASGTKL 600
    TEPRKNHVFG GKKGSNVESR PASDGSLQHA RPTPFFMDPI YRVEKRKLTD 650
    PLEALKEKYL RPSPGFLFHP QFQLPDQRTW MSAIENMAEK LESFSALKPE 700
    ASELLQSVPS MFNFRAPPNA LPENLLRKGK ERYTCRYCGK IFPRSANLTR 750
    HLRTHTGEQP YRCKYCDRSF SISSNLQRHV RNIHNKEKPF KCHLCDRCFG 800
    QQTNLDRHLK KHENGNMSGT ATSSPHSELE STGAILDDKE DAYFTEIRNF 850
    IGNSNHGSQS PRNVEERMNG SHFKDEKALV TSQNSDLLDD EEVEDEVLLD 900
    EEDEDNDITG KTGKEPVTSN LHEGNPEDDY EETSALEMSC KTSPVRYKEE 950
    EYKSGLSALD HIRHFTDSLK MRKMEDNQYS EAELSSFSTS HVPEELKQPL 1000
    HRKSKSQAYA MMLSLSDKES LHSTSHSSSN VWHSMARAAA ESSAIQSISH 1050
    V 1051
    Length:1,051
    Mass (Da):118,276
    Last modified:April 17, 2007 - v2
    Checksum:iBD132C53EA08D263
    GO
    Isoform 2 (identifier: Q03112-3) [UniParc]FASTAAdd to Basket

    Also known as: Evi-1c, Mds1/Evi1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRSKGRARKL...APGEELLLFM

    Note: Produced by alternative promoter usage. Contains an additional SET domain at positions 79-194. Unable to form homooligomers, to interact with CTBP1 and SMAD3 and to repress TGF-beta signaling.

    Show »
    Length:1,239
    Mass (Da):139,308
    Checksum:iE8A5EAD310102D53
    GO
    Isoform 3 (identifier: Q13465-1) [UniParc]FASTAAdd to Basket

    Also known as: Mds1

    The sequence of this isoform can be found in the external entry Q13465.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: Produced by alternative promoter usage.

    Length:169
    Mass (Da):18,696
    GO
    Isoform 4 (identifier: Q03112-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFM
         138-138: K → KQ

    Show »
    Length:1,116
    Mass (Da):125,807
    Checksum:i772D3F793270B394
    GO
    Isoform 5 (identifier: Q03112-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         672-680: Missing.

    Show »
    Length:1,042
    Mass (Da):117,104
    Checksum:i97476C1D04DB2007
    GO
    Isoform 6 (identifier: Q03112-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         138-138: K → KQ
         672-680: Missing.

    Show »
    Length:1,043
    Mass (Da):117,232
    Checksum:iB6A0605E499FF208
    GO

    Sequence cautioni

    The sequence AAB37456.1 differs from that shown. Reason: Probable cloning artifact.
    The sequence BAH14103.1 differs from that shown. Reason: Aberrant splicing.
    The sequence AAB29907.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAI30521.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti20 – 201Q → R in CAE45952. (PubMed:17974005)Curated
    Sequence conflicti175 – 1751L → P in CAE45952. (PubMed:17974005)Curated
    Sequence conflicti301 – 3011F → S in BAF85554. (PubMed:14702039)Curated
    Sequence conflicti303 – 3031F → V in CAA38735. (PubMed:2115646)Curated
    Sequence conflicti443 – 4431S → P in CAI46086. (PubMed:17974005)Curated
    Sequence conflicti543 – 5431K → R in CAE45952. (PubMed:17974005)Curated
    Sequence conflicti730 – 7301K → R in BAF85554. (PubMed:14702039)Curated
    Sequence conflicti741 – 7411I → V in CAI46086. (PubMed:17974005)Curated
    Sequence conflicti796 – 7961D → Y in CAA38735. (PubMed:2115646)Curated
    Sequence conflicti875 – 8751D → E in CAA38735. (PubMed:2115646)Curated
    Sequence conflicti881 – 8811T → P in CAA38735. (PubMed:2115646)Curated
    Sequence conflicti906 – 9061N → Y in CAA38735. (PubMed:2115646)Curated
    Sequence conflicti992 – 9921V → A in BAF85554. (PubMed:14702039)Curated
    Sequence conflicti1013 – 10131L → P in CAE45952. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti107 – 1071Q → R.
    Corresponds to variant rs34896995 [ dbSNP | Ensembl ].
    VAR_061928

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MRSKGRARKLATNNECVYGN YPEIPLEEMPDADGVASTPS LNIQEPCSPATSSEAFTPKE GSPYKAPIYIPDDIPIPAEF ELRESNMPGAGLGIWTKRKI EVGEKFGPYVGEQRSNLKDP SYGWEILDEFYNVKFCIDAS QPDVGSWLKYIRFAGCYDQH NLVACQINDQIFYRVVADIA PGEELLLFM in isoform 2. 1 PublicationVSP_038733
    Alternative sequencei1 – 11M → MILDEFYNVKFCIDASQPDV GSWLKYIRFAGCYDQHNLVA CQINDQIFYRVVADIAPGEE LLLFM in isoform 4. 1 PublicationVSP_038734
    Alternative sequencei138 – 1381K → KQ in isoform 4 and isoform 6. 1 PublicationVSP_038735
    Alternative sequencei672 – 6809Missing in isoform 5 and isoform 6. 3 PublicationsVSP_038736

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X54989 mRNA. Translation: CAA38735.1.
    S69002 mRNA. Translation: AAB29907.1. Different initiation.
    AK292865 mRNA. Translation: BAF85554.1.
    AK304098 mRNA. Translation: BAH14103.1. Sequence problems.
    BX640908 mRNA. Translation: CAE45952.1.
    BX647613 mRNA. Translation: CAI46086.1.
    AC007849 Genomic DNA. No translation available.
    AC024099 Genomic DNA. No translation available.
    AC069220 Genomic DNA. No translation available.
    AC074033 Genomic DNA. No translation available.
    AC078985 Genomic DNA. No translation available.
    CH471052 Genomic DNA. Translation: EAW78553.1.
    CH471052 Genomic DNA. Translation: EAW78556.1.
    CH471052 Genomic DNA. Translation: EAW78557.1.
    BC031019 mRNA. Translation: AAH31019.1.
    BC130520 mRNA. Translation: AAI30521.1. Different initiation.
    BC143951 mRNA. Translation: AAI43952.1.
    BC143952 mRNA. Translation: AAI43953.1.
    S82592 mRNA. Translation: AAB37456.1. Sequence problems.
    CCDSiCCDS3205.1. [Q03112-1]
    CCDS54669.1. [Q03112-5]
    CCDS54670.1. [Q03112-4]
    PIRiA60191.
    S41705.
    RefSeqiNP_001098547.3. NM_001105077.3. [Q03112-4]
    NP_001098548.2. NM_001105078.3. [Q03112-1]
    NP_001157471.1. NM_001163999.1. [Q03112-6]
    NP_001157472.1. NM_001164000.1. [Q03112-5]
    NP_001192123.1. NM_001205194.1. [Q03112-1]
    NP_004982.2. NM_004991.3. [Q03112-3]
    NP_005232.2. NM_005241.3. [Q03112-1]
    XP_005247276.1. XM_005247219.1.
    XP_005247277.1. XM_005247220.1.
    XP_005247278.1. XM_005247221.1.
    XP_005247280.1. XM_005247223.1. [Q03112-1]
    XP_006713599.1. XM_006713536.1. [Q03112-4]
    UniGeneiHs.744090.

    Genome annotation databases

    EnsembliENST00000264674; ENSP00000264674; ENSG00000085276. [Q03112-4]
    ENST00000433243; ENSP00000394302; ENSG00000085276.
    ENST00000464456; ENSP00000419770; ENSG00000085276. [Q03112-5]
    ENST00000468789; ENSP00000419995; ENSG00000085276. [Q03112-1]
    ENST00000472280; ENSP00000420048; ENSG00000085276.
    GeneIDi2122.
    KEGGihsa:2122.
    UCSCiuc003ffi.3. human. [Q03112-1]
    uc003ffj.3. human. [Q03112-4]
    uc003ffk.2. human. [Q03112-5]
    uc011bpi.1. human. [Q03112-6]
    uc011bpj.1. human. [Q03112-3]

    Polymorphism databases

    DMDMi145559472.

    Keywords - Coding sequence diversityi

    Alternative promoter usage, Alternative splicing, Chromosomal rearrangement, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X54989 mRNA. Translation: CAA38735.1 .
    S69002 mRNA. Translation: AAB29907.1 . Different initiation.
    AK292865 mRNA. Translation: BAF85554.1 .
    AK304098 mRNA. Translation: BAH14103.1 . Sequence problems.
    BX640908 mRNA. Translation: CAE45952.1 .
    BX647613 mRNA. Translation: CAI46086.1 .
    AC007849 Genomic DNA. No translation available.
    AC024099 Genomic DNA. No translation available.
    AC069220 Genomic DNA. No translation available.
    AC074033 Genomic DNA. No translation available.
    AC078985 Genomic DNA. No translation available.
    CH471052 Genomic DNA. Translation: EAW78553.1 .
    CH471052 Genomic DNA. Translation: EAW78556.1 .
    CH471052 Genomic DNA. Translation: EAW78557.1 .
    BC031019 mRNA. Translation: AAH31019.1 .
    BC130520 mRNA. Translation: AAI30521.1 . Different initiation.
    BC143951 mRNA. Translation: AAI43952.1 .
    BC143952 mRNA. Translation: AAI43953.1 .
    S82592 mRNA. Translation: AAB37456.1 . Sequence problems.
    CCDSi CCDS3205.1. [Q03112-1 ]
    CCDS54669.1. [Q03112-5 ]
    CCDS54670.1. [Q03112-4 ]
    PIRi A60191.
    S41705.
    RefSeqi NP_001098547.3. NM_001105077.3. [Q03112-4 ]
    NP_001098548.2. NM_001105078.3. [Q03112-1 ]
    NP_001157471.1. NM_001163999.1. [Q03112-6 ]
    NP_001157472.1. NM_001164000.1. [Q03112-5 ]
    NP_001192123.1. NM_001205194.1. [Q03112-1 ]
    NP_004982.2. NM_004991.3. [Q03112-3 ]
    NP_005232.2. NM_005241.3. [Q03112-1 ]
    XP_005247276.1. XM_005247219.1.
    XP_005247277.1. XM_005247220.1.
    XP_005247278.1. XM_005247221.1.
    XP_005247280.1. XM_005247223.1. [Q03112-1 ]
    XP_006713599.1. XM_006713536.1. [Q03112-4 ]
    UniGenei Hs.744090.

    3D structure databases

    ProteinModelPortali Q03112.
    SMRi Q03112. Positions 19-237, 733-813.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 108423. 18 interactions.
    DIPi DIP-38639N.
    IntActi Q03112. 3 interactions.
    STRINGi 9606.ENSP00000264674.

    PTM databases

    PhosphoSitei Q03112.

    Polymorphism databases

    DMDMi 145559472.

    Proteomic databases

    MaxQBi Q03112.
    PaxDbi Q03112.
    PRIDEi Q03112.

    Protocols and materials databases

    DNASUi 2122.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000264674 ; ENSP00000264674 ; ENSG00000085276 . [Q03112-4 ]
    ENST00000433243 ; ENSP00000394302 ; ENSG00000085276 .
    ENST00000464456 ; ENSP00000419770 ; ENSG00000085276 . [Q03112-5 ]
    ENST00000468789 ; ENSP00000419995 ; ENSG00000085276 . [Q03112-1 ]
    ENST00000472280 ; ENSP00000420048 ; ENSG00000085276 .
    GeneIDi 2122.
    KEGGi hsa:2122.
    UCSCi uc003ffi.3. human. [Q03112-1 ]
    uc003ffj.3. human. [Q03112-4 ]
    uc003ffk.2. human. [Q03112-5 ]
    uc011bpi.1. human. [Q03112-6 ]
    uc011bpj.1. human. [Q03112-3 ]

    Organism-specific databases

    CTDi 2122.
    GeneCardsi GC03M168802.
    H-InvDB HIX0003836.
    HGNCi HGNC:3498. MECOM.
    HPAi HPA046537.
    MIMi 165215. gene.
    neXtProti NX_Q03112.
    Orphaneti 52688. Myelodysplastic syndromes.
    PharmGKBi PA27912.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOVERGENi HBG005619.
    InParanoidi Q03112.
    KOi K04462.
    OrthoDBi EOG72G16H.
    PhylomeDBi Q03112.
    TreeFami TF315309.

    Enzyme and pathway databases

    SignaLinki Q03112.

    Miscellaneous databases

    ChiTaRSi MECOM. human.
    GeneWikii MECOM.
    GenomeRNAii 2122.
    NextBioi 8579.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q03112.
    Bgeei Q03112.
    CleanExi HS_EVI1.
    Genevestigatori Q03112.

    Family and domain databases

    Gene3Di 3.30.160.60. 8 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF00096. zf-C2H2. 10 hits.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 10 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 8 hits.
    PS50157. ZINC_FINGER_C2H2_2. 10 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Unique expression of the human Evi-1 gene in an endometrial carcinoma cell line: sequence of cDNAs and structure of alternatively spliced transcripts."
      Morishita K., Parganas E., Douglass E.C., Ihle J.N.
      Oncogene 5:963-971(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ALTERNATIVE SPLICING.
    2. "Generation of the AML1-EVI-1 fusion gene in the t(3;21)(q26;q22) causes blastic crisis in chronic myelocytic leukemia."
      Mitani K., Ogawa S., Tanaka T., Miyoshi H., Kurokawa M., Mano H., Yazaki Y., Ohki M., Hirai H.
      EMBO J. 13:504-510(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), CHROMOSOMAL TRANSLOCATION WITH RUNX1 IN CHRONIC MYELOCYTIC LEUKEMIA.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-759 (ISOFORM 2).
      Tissue: Trachea.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Adipose tissue and Fetal kidney.
    5. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 6), NUCLEOTIDE SEQUENCE [MRNA] OF 516-1051 (ISOFORM 5).
      Tissue: Lung.
    8. "Structurally altered Evi-1 protein generated in the 3q21q26 syndrome."
      Ogawa S., Kurokawa M., Tanaka T., Mitani K., Inazawa J., Hangaishi A., Tanaka K., Matsuo Y., Minowada J., Tsubota T., Yazaki Y., Hirai H.
      Oncogene 13:183-191(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 970-1007 (ISOFORM 1).
    9. "The oncoprotein Evi-1 represses TGF-beta signalling by inhibiting Smad3."
      Kurokawa M., Mitani K., Irie K., Matsuyama T., Takahashi T., Chiba S., Yazaki Y., Matsumoto K., Hirai H.
      Nature 394:92-96(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN TGF-BETA SIGNALING, INTERACTION WITH SMAD3 AND SMAD4, SUBCELLULAR LOCATION.
    10. "The evi-1 oncoprotein inhibits c-Jun N-terminal kinase and prevents stress-induced cell death."
      Kurokawa M., Mitani K., Yamagata T., Takahashi T., Izutsu K., Ogawa S., Moriguchi T., Nishida E., Yazaki Y., Hirai H.
      EMBO J. 19:2958-2968(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH MAPK8 AND MAPK9.
    11. "Interaction of EVI1 with cAMP-responsive element-binding protein-binding protein (CBP) and p300/CBP-associated factor (P/CAF) results in reversible acetylation of EVI1 and in co-localization in nuclear speckles."
      Chakraborty S., Senyuk V., Sitailo S., Chi Y., Nucifora G.
      J. Biol. Chem. 276:44936-44943(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, ACETYLATION, INTERACTION WITH CREBBP; CTBP1; KAT2B AND HISTONE DEACETYLASES, SUBCELLULAR LOCATION, MUTAGENESIS OF 555-ASP-LEU-556 AND 586-ASP-LEU-587.
    12. "Oligomerization of Evi-1 regulated by the PR domain contributes to recruitment of corepressor CtBP."
      Nitta E., Izutsu K., Yamaguchi Y., Imai Y., Ogawa S., Chiba S., Kurokawa M., Hirai H.
      Oncogene 24:6165-6173(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, ALTERNATIVE SPLICING (ISOFORMS 1 AND 2), HOMOOLIGOMERIZATION, INTERACTION WITH CTBP1 AND SMAD3, SUBCELLULAR LOCATION.
    13. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. "Evi1 is a survival factor which conveys resistance to both TGFbeta- and taxol-mediated cell death via PI3K/AKT."
      Liu Y., Chen L., Ko T.C., Fields A.P., Thompson E.A.
      Oncogene 25:3565-3575(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN APOPTOSIS.
    15. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    16. "Pbx1 is a downstream target of Evi-1 in hematopoietic stem/progenitors and leukemic cells."
      Shimabe M., Goyama S., Watanabe-Okochi N., Yoshimi A., Ichikawa M., Imai Y., Kurokawa M.
      Oncogene 28:4364-4374(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    17. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-860, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiEVI1_HUMAN
    AccessioniPrimary (citable) accession number: Q03112
    Secondary accession number(s): A1L4F3
    , A8KA00, B7Z8W7, B7ZLQ3, B7ZLQ4, C9JAK0, D3DNP7, Q16122, Q5HYI1, Q6MZS6, Q8NEI5, Q99917
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 1994
    Last sequence update: April 17, 2007
    Last modified: October 1, 2014
    This is version 142 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3