Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q02936

- HH_DROME

UniProt

Q02936 - HH_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein hedgehog

Gene

hh

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Intercellular signal essential for a variety of patterning events during development. Establishes the anterior-posterior axis of the embryonic segments and patterns the larval imaginal disks. Binds to the patched (ptc) receptor, which functions in association with smoothened (smo), to activate the transcription of target genes wingless (wg), decapentaplegic (dpp) and ptc. In the absence of hh, ptc represses the constitutive signaling activity of smo through fused (fu).
The hedgehog protein N-product constitutes the active species in both local and long-range signaling, whereas the C-terminal product has no signaling activity. It acts as a morphogen, and diffuses long distances despite its lipidation. Heparan sulfate proteoglycans of the extracellular matrix play an essential role in diffusion. Lipophorin is required for diffusion, probably by acting as vehicle for its movement, explaining how it can spread over long distances despite its lipidation.
The hedgehog protein C-product, which mediates the autocatalytic activity, has no signaling activity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei257 – 2582Cleavage; by autolysis
Sitei303 – 3031Involved in cholesterol transfer
Sitei326 – 3261Involved in auto-cleavage
Sitei329 – 3291Essential for auto-cleavage

GO - Molecular functioni

  1. morphogen activity Source: FlyBase
  2. patched binding Source: UniProtKB
  3. peptidase activity Source: UniProtKB-KW
  4. smoothened binding Source: UniProtKB

GO - Biological processi

  1. analia development Source: FlyBase
  2. anterior/posterior axis specification, embryo Source: FlyBase
  3. anterior/posterior lineage restriction, imaginal disc Source: FlyBase
  4. anterior commissure morphogenesis Source: FlyBase
  5. anterior head segmentation Source: FlyBase
  6. Bolwig's organ morphogenesis Source: FlyBase
  7. cell-cell signaling involved in cell fate commitment Source: UniProtKB
  8. compartment pattern specification Source: FlyBase
  9. compound eye morphogenesis Source: FlyBase
  10. compound eye photoreceptor cell differentiation Source: FlyBase
  11. cytoneme assembly Source: FlyBase
  12. developmental pigmentation Source: FlyBase
  13. ectoderm development Source: FlyBase
  14. embryonic pattern specification Source: UniProtKB
  15. epidermis development Source: FlyBase
  16. epithelial cell migration, open tracheal system Source: FlyBase
  17. eye morphogenesis Source: FlyBase
  18. foregut morphogenesis Source: FlyBase
  19. genital disc anterior/posterior pattern formation Source: FlyBase
  20. genital disc development Source: FlyBase
  21. germ cell attraction Source: FlyBase
  22. germ cell migration Source: FlyBase
  23. germ-line stem cell division Source: FlyBase
  24. glial cell migration Source: FlyBase
  25. gonadal mesoderm development Source: FlyBase
  26. growth Source: FlyBase
  27. heart development Source: FlyBase
  28. heart formation Source: FlyBase
  29. hindgut morphogenesis Source: FlyBase
  30. imaginal disc-derived wing vein specification Source: FlyBase
  31. imaginal disc growth Source: FlyBase
  32. imaginal disc pattern formation Source: FlyBase
  33. intein-mediated protein splicing Source: InterPro
  34. labial disc development Source: FlyBase
  35. leg disc morphogenesis Source: FlyBase
  36. mesoderm development Source: FlyBase
  37. morphogenesis of larval imaginal disc epithelium Source: FlyBase
  38. negative regulation of protein ubiquitination Source: FlyBase
  39. negative regulation of proteolysis Source: FlyBase
  40. open tracheal system development Source: FlyBase
  41. ovarian follicle cell development Source: FlyBase
  42. ovarian follicle cell stalk formation Source: FlyBase
  43. pole cell migration Source: FlyBase
  44. positive regulation of fibroblast growth factor receptor signaling pathway Source: FlyBase
  45. positive regulation of hh target transcription factor activity Source: FlyBase
  46. positive regulation of smoothened signaling pathway Source: FlyBase
  47. positive regulation of transcription factor import into nucleus Source: FlyBase
  48. posterior head segmentation Source: FlyBase
  49. progression of morphogenetic furrow involved in compound eye morphogenesis Source: FlyBase
  50. protein autoprocessing Source: UniProtKB
  51. R8 cell fate specification Source: FlyBase
  52. regulation of cell proliferation Source: FlyBase
  53. regulation of epithelial cell migration, open tracheal system Source: FlyBase
  54. regulation of mitotic cell cycle Source: FlyBase
  55. regulation of organ growth Source: FlyBase
  56. regulation of protein import into nucleus Source: FlyBase
  57. regulation of transcription from RNA polymerase II promoter Source: FlyBase
  58. segment polarity determination Source: UniProtKB
  59. smoothened signaling pathway Source: FlyBase
  60. somatic stem cell division Source: FlyBase
  61. spiracle morphogenesis, open tracheal system Source: FlyBase
  62. trunk segmentation Source: FlyBase
  63. ventral midline development Source: FlyBase
  64. wing disc anterior/posterior pattern formation Source: FlyBase
  65. wing disc proximal/distal pattern formation Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Hydrolase, Morphogen, Protease, Segmentation polarity protein

Enzyme and pathway databases

SignaLinkiQ02936.

Protein family/group databases

MEROPSiC46.001.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein hedgehog
Cleaved into the following 2 chains:
Protein hedgehog N-product
Short name:
Hh-Np
Short name:
N-Hh
Alternative name(s):
C-Hh
Gene namesi
Name:hh
ORF Names:CG4637
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome 3R

Organism-specific databases

FlyBaseiFBgn0004644. hh.

Subcellular locationi

Nucleus 1 Publication. Cytoplasm 1 Publication
Note: Nuclear up to embryonic stage 10 and then at stage 11 shifts to the cytoplasm. Also secreted in either cleaved or uncleaved form to mediate signaling to other cells.
Chain Protein hedgehog N-product : Cell membrane; Lipid-anchor; Extracellular side
Note: The N-terminal peptide remains associated with the cell surface.
Chain Protein hedgehog C-product : Secretedextracellular space
Note: The C-terminal peptide diffuses from the cell.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. cytoplasmic membrane-bounded vesicle Source: FlyBase
  3. endocytic vesicle Source: FlyBase
  4. endosome Source: FlyBase
  5. extracellular region Source: UniProtKB
  6. extracellular space Source: FlyBase
  7. nucleus Source: UniProtKB
  8. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi85 – 851C → S: N-product is made but fails to undergo palmitoylation. 2 Publications
Mutagenesisi303 – 3031D → A: No cholesterol transfer. 1 Publication
Mutagenesisi326 – 3261T → A: Greatly reduced autoprocessing activity. 1 Publication
Mutagenesisi329 – 3291H → A: No autoprocessing activity. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Propeptidei? – 84Sequence AnalysisPRO_0000383048
Signal peptidei1 – ?Sequence Analysis
Chaini85 – 471387Protein hedgehogPRO_0000013202Add
BLAST
Chaini85 – 257173Protein hedgehog N-productPRO_0000013203Add
BLAST
Chaini258 – 471214Protein hedgehog C-productPRO_0000013204Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi85 – 851N-palmitoyl cysteine1 Publication
Lipidationi257 – 2571Cholesterol glycine ester

Post-translational modificationi

The C-terminal domain displays autoproteolytic activity. Cleavage of the full-length hedgehog protein is followed by the covalent attachment of a cholesterol moiety to the C-terminus of the newly generated N-terminal fragment (N-product).
Cholesterol attachment plays an essential role in restricting the spatial distribution of hedgehog activity to the cell surface.
N-terminal palmitoylation of the hedgehog N-product is required for the embryonic and larval patterning activities of the hedgehog signal. Rasp acts within the secretory pathway to catalyze the N-terminal palmitoylation of Hh.1 Publication

Keywords - PTMi

Autocatalytic cleavage, Lipoprotein, Palmitate

Miscellaneous databases

PMAP-CutDBQ02936.

Expressioni

Tissue specificityi

In embryos, expression starts at stage 5 as a few stripes at the anterior and posterior ends, this expands to 17 stripes during stages 8-11. Expression is also seen in CNS and some PNS cells until stage 13-14, and in foregut, hindgut and salivary glands. In larvae, expression is seen in the posterior compartment of the wing imaginal disk.4 Publications

Developmental stagei

Expressed in embryos, larvae and pupae at high levels with maximum expression in 6-12 hours embryos and 0-24 hours pupae. Low levels of expression are seen in adults.4 Publications

Gene expression databases

BgeeiQ02936.

Interactioni

Subunit structurei

Interacts with shf.1 Publication

Protein-protein interaction databases

BioGridi67682. 37 interactions.
DIPiDIP-51313N.
IntActiQ02936. 2 interactions.
STRINGi7227.FBpp0099945.

Structurei

Secondary structure

1
471
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi107 – 1115
Turni116 – 1194
Helixi131 – 1355
Beta strandi144 – 1463
Helixi160 – 17617
Beta strandi182 – 1887
Helixi199 – 2024
Beta strandi205 – 2106
Helixi215 – 2173
Helixi218 – 22811
Beta strandi231 – 2344
Beta strandi241 – 2444
Beta strandi264 – 2674
Beta strandi272 – 2743
Helixi275 – 2773
Beta strandi283 – 2875
Beta strandi293 – 31725
Beta strandi322 – 3254
Beta strandi330 – 3356
Turni336 – 3394
Beta strandi340 – 3456
Helixi346 – 3483
Beta strandi354 – 3585
Turni360 – 3623
Beta strandi365 – 39329
Beta strandi396 – 4005

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1AT0X-ray1.90A258-402[»]
2IBGX-ray2.20E/F/G/H99-248[»]
ProteinModelPortaliQ02936.
SMRiQ02936. Positions 100-248, 258-402.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ02936.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi5 – 4137Ser-richAdd
BLAST

Sequence similaritiesi

Belongs to the hedgehog family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG250647.
GeneTreeiENSGT00390000001117.
InParanoidiQ02936.
KOiK06224.
OMAiHSCGPGR.
OrthoDBiEOG779NZ5.
PhylomeDBiQ02936.

Family and domain databases

Gene3Di2.170.16.10. 1 hit.
3.30.1380.10. 1 hit.
InterProiIPR001657. Hedgehog.
IPR028992. Hedgehog/Intein_dom.
IPR009045. Hedgehog_sig/DD-Pept_Zn-bd_dom.
IPR000320. Hedgehog_signalling_dom.
IPR001767. Hint_dom.
IPR003586. Hint_dom_C.
IPR003587. Hint_dom_N.
IPR006141. Intein_splice_site.
[Graphical view]
PfamiPF01085. HH_signal. 1 hit.
PF01079. Hint. 1 hit.
[Graphical view]
PIRSFiPIRSF009400. Peptidase_C46. 1 hit.
PRINTSiPR00632. SONICHHOG.
SMARTiSM00305. HintC. 1 hit.
SM00306. HintN. 1 hit.
[Graphical view]
SUPFAMiSSF51294. SSF51294. 1 hit.
SSF55166. SSF55166. 1 hit.
PROSITEiPS50817. INTEIN_N_TER. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform Long (identifier: Q02936-1) [UniParc]FASTAAdd to Basket

Also known as: A, B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDNHSSVPWA SAASVTCLSL DAKCHSSSSS SSSKSAASSI SAIPQEETQT
60 70 80 90 100
MRHIAHTQRC LSRLTSLVAL LLIVLPMVFS PAHSCGPGRG LGRHRARNLY
110 120 130 140 150
PLVLKQTIPN LSEYTNSASG PLEGVIRRDS PKFKDLVPNY NRDILFRDEE
160 170 180 190 200
GTGADRLMSK RCKEKLNVLA YSVMNEWPGI RLLVTESWDE DYHHGQESLH
210 220 230 240 250
YEGRAVTIAT SDRDQSKYGM LARLAVEAGF DWVSYVSRRH IYCSVKSDSS
260 270 280 290 300
ISSHVHGCFT PESTALLESG VRKPLGELSI GDRVLSMTAN GQAVYSEVIL
310 320 330 340 350
FMDRNLEQMQ NFVQLHTDGG AVLTVTPAHL VSVWQPESQK LTFVFADRIE
360 370 380 390 400
EKNQVLVRDV ETGELRPQRV VKVGSVRSKG VVAPLTREGT IVVNSVAASC
410 420 430 440 450
YAVINSQSLA HWGLAPMRLL STLEAWLPAK EQLHSSPKVV SSAQQQNGIH
460 470
WYANALYKVK DYVLPQSWRH D
Length:471
Mass (Da):52,150
Last modified:September 1, 2009 - v4
Checksum:i8ECD796A92FE7043
GO
Isoform Short (identifier: Q02936-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     161-192: RCKEKLNVLAYSVMNEWPGIRLLVTESWDEDY → VRKTLKHRKLVTKFVIHHWESFAYRNHCDKVT
     193-471: Missing.

Show »
Length:192
Mass (Da):21,323
Checksum:iC19D4D9EF4367D47
GO

Sequence cautioni

The sequence AAA28604.1 differs from that shown. Reason: Frameshift at positions 21 and 48.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti156 – 1561R → G in AAA28604. (PubMed:8166882)Curated
Sequence conflicti347 – 3471D → H in AAA28604. (PubMed:8166882)Curated
Sequence conflicti373 – 3731V → L in AAA28604. (PubMed:8166882)Curated
Sequence conflicti407 – 4071Q → P in Z11840. (PubMed:1280560)Curated

Mass spectrometryi

Molecular mass is 20238.44 Da from positions 85 - 257. Determined by MALDI. 1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei161 – 19232RCKEK…WDEDY → VRKTLKHRKLVTKFVIHHWE SFAYRNHCDKVT in isoform Short. CuratedVSP_002065Add
BLAST
Alternative sequencei193 – 471279Missing in isoform Short. CuratedVSP_002066Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L05404 mRNA. Translation: AAA28604.1. Frameshift.
L05405 Genomic DNA. No translation available.
L02793 Unassigned DNA. Translation: AAA16458.1.
Z11840 Genomic DNA. No translation available.
S66384 mRNA. Translation: AAB28646.1.
AE014297 Genomic DNA. Translation: AAF56102.1.
AE014297 Genomic DNA. Translation: ABC66186.1.
PIRiA46400.
RefSeqiNP_001034065.1. NM_001038976.1. [Q02936-1]
UniGeneiDm.2371.

Genome annotation databases

EnsemblMetazoaiFBtr0100506; FBpp0099945; FBgn0004644. [Q02936-1]
GeneIDi42737.
KEGGidme:Dmel_CG4637.
UCSCiCG4637-RA. d. melanogaster. [Q02936-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L05404 mRNA. Translation: AAA28604.1 . Frameshift.
L05405 Genomic DNA. No translation available.
L02793 Unassigned DNA. Translation: AAA16458.1 .
Z11840 Genomic DNA. No translation available.
S66384 mRNA. Translation: AAB28646.1 .
AE014297 Genomic DNA. Translation: AAF56102.1 .
AE014297 Genomic DNA. Translation: ABC66186.1 .
PIRi A46400.
RefSeqi NP_001034065.1. NM_001038976.1. [Q02936-1 ]
UniGenei Dm.2371.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1AT0 X-ray 1.90 A 258-402 [» ]
2IBG X-ray 2.20 E/F/G/H 99-248 [» ]
ProteinModelPortali Q02936.
SMRi Q02936. Positions 100-248, 258-402.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 67682. 37 interactions.
DIPi DIP-51313N.
IntActi Q02936. 2 interactions.
STRINGi 7227.FBpp0099945.

Protein family/group databases

MEROPSi C46.001.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai FBtr0100506 ; FBpp0099945 ; FBgn0004644 . [Q02936-1 ]
GeneIDi 42737.
KEGGi dme:Dmel_CG4637.
UCSCi CG4637-RA. d. melanogaster. [Q02936-1 ]

Organism-specific databases

CTDi 42737.
FlyBasei FBgn0004644. hh.

Phylogenomic databases

eggNOGi NOG250647.
GeneTreei ENSGT00390000001117.
InParanoidi Q02936.
KOi K06224.
OMAi HSCGPGR.
OrthoDBi EOG779NZ5.
PhylomeDBi Q02936.

Enzyme and pathway databases

SignaLinki Q02936.

Miscellaneous databases

EvolutionaryTracei Q02936.
GenomeRNAii 42737.
NextBioi 830301.
PMAP-CutDB Q02936.
PROi Q02936.

Gene expression databases

Bgeei Q02936.

Family and domain databases

Gene3Di 2.170.16.10. 1 hit.
3.30.1380.10. 1 hit.
InterProi IPR001657. Hedgehog.
IPR028992. Hedgehog/Intein_dom.
IPR009045. Hedgehog_sig/DD-Pept_Zn-bd_dom.
IPR000320. Hedgehog_signalling_dom.
IPR001767. Hint_dom.
IPR003586. Hint_dom_C.
IPR003587. Hint_dom_N.
IPR006141. Intein_splice_site.
[Graphical view ]
Pfami PF01085. HH_signal. 1 hit.
PF01079. Hint. 1 hit.
[Graphical view ]
PIRSFi PIRSF009400. Peptidase_C46. 1 hit.
PRINTSi PR00632. SONICHHOG.
SMARTi SM00305. HintC. 1 hit.
SM00306. HintN. 1 hit.
[Graphical view ]
SUPFAMi SSF51294. SSF51294. 1 hit.
SSF55166. SSF55166. 1 hit.
PROSITEi PS50817. INTEIN_N_TER. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Structure and expression of hedgehog, a Drosophila segment-polarity gene required for cell-cell communication."
    Tashiro S., Michiue T., Higashijima S., Zenno S., Ishimaru S., Takahashi F., Orihara M., Kojima T., Saigo K.
    Gene 124:183-189(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM LONG), FUNCTION, DEVELOPMENTAL STAGE, TISSUE SPECIFICITY.
    Strain: Canton-S.
    Tissue: Embryo.
  2. "Secretion and localized transcription suggest a role in positional signaling for products of the segmentation gene hedgehog."
    Lee J.J., von Kessler D.P., Parks S., Beachy P.A.
    Cell 71:33-50(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION, DEVELOPMENTAL STAGE, TISSUE SPECIFICITY.
  3. "Molecular organization and embryonic expression of the hedgehog gene involved in cell-cell communication in segmental patterning of Drosophila."
    Mohler J., Vani K.
    Development 115:957-971(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, TISSUE SPECIFICITY.
    Strain: Oregon-R.
    Tissue: Embryo.
  4. "The Drosophila hedgehog gene is expressed specifically in posterior compartment cells and is a target of engrailed regulation."
    Tabata T., Eaton S., Kornberg T.B.
    Genes Dev. 6:2635-2645(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG), FUNCTION, DEVELOPMENTAL STAGE, TISSUE SPECIFICITY.
    Strain: Oregon-R.
    Tissue: Embryo.
  5. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  6. Cited for: GENOME REANNOTATION.
    Strain: Berkeley.
  7. "The product of hedgehog autoproteolytic cleavage active in local and long-range signalling."
    Porter J.A., von Kessler D.P., Ekker S.C., Young K.E., Lee J.J., Moses K., Beachy P.A.
    Nature 374:363-366(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: AUTOCATALYTIC CLEAVAGE, PROTEOLYTIC PROCESSING.
  8. "An acylatable residue of Hedgehog is differentially required in Drosophila and mouse limb development."
    Lee J.D., Kraus P., Gaiano N., Nery S., Kohtz J., Fishell G., Loomis C.A., Treisman J.E.
    Dev. Biol. 233:122-136(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF CYS-85.
  9. "Skinny hedgehog, an acyltransferase required for palmitoylation and activity of the hedgehog signal."
    Chamoun Z., Mann R.K., Nellen D., von Kessler D.P., Bellotto M., Beachy P.A., Basler K.
    Science 293:2080-2084(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: PALMITOYLATION AT CYS-85, MUTAGENESIS OF CYS-85, MASS SPECTROMETRY.
  10. "Cholesterol modification of hedgehog is required for trafficking and movement, revealing an asymmetric cellular response to hedgehog."
    Gallet A., Rodriguez R., Ruel L., Therond P.P.
    Dev. Cell 4:191-204(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: ROLE OF CHOLESTEROL.
  11. "The Drosophila ortholog of the human wnt inhibitor factor shifted controls the diffusion of lipid-modified hedgehog."
    Gorfinkiel N., Sierra J., Callejo A., Ibanez C., Guerrero I.
    Dev. Cell 8:241-253(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SHF.
  12. "Lipoprotein particles are required for Hedgehog and Wingless signalling."
    Panakova D., Sprong H., Marois E., Thiele C., Eaton S.
    Nature 435:58-65(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: ROLE OF LIPOPHORIN IN MOVEMENT.
  13. "Crystal structure of a Hedgehog autoprocessing domain: homology between Hedgehog and self-splicing proteins."
    Hall T.M.T., Porter J.A., Young K.E., Koonin E.V., Beachy P.A., Leahy D.J.
    Cell 91:85-97(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 258-402, MUTAGENESIS.

Entry informationi

Entry nameiHH_DROME
AccessioniPrimary (citable) accession number: Q02936
Secondary accession number(s): A4V396, Q9VCQ4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: September 1, 2009
Last modified: October 29, 2014
This is version 165 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3