Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q02780

- NFIA_MOUSE

UniProt

Q02780 - NFIA_MOUSE

Protein

Nuclear factor 1 A-type

Gene

Nfia

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 136 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi24 – 217194CTF/NF-IPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: MGI
    2. sequence-specific DNA binding transcription factor activity Source: InterPro

    GO - Biological processi

    1. DNA replication Source: UniProtKB-KW
    2. positive regulation of transcription from RNA polymerase II promoter Source: MGI
    3. response to organic cyclic compound Source: Ensembl
    4. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    DNA replication, Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_221403. RNA Polymerase III Transcription Termination.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear factor 1 A-type
    Short name:
    NF1-A
    Short name:
    Nuclear factor 1/A
    Alternative name(s):
    CCAAT-box-binding transcription factor
    Short name:
    CTF
    Nuclear factor I/A
    Short name:
    NF-I/A
    Short name:
    NFI-A
    TGGCA-binding protein
    Gene namesi
    Name:Nfia
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 4

    Organism-specific databases

    MGIiMGI:108056. Nfia.

    Subcellular locationi

    GO - Cellular componenti

    1. cell junction Source: Ensembl
    2. nucleus Source: MGI

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 532532Nuclear factor 1 A-typePRO_0000100192Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei281 – 2811PhosphoserineBy similarity
    Modified residuei288 – 2881PhosphoserineBy similarity
    Modified residuei303 – 3031Phosphoserine1 Publication
    Modified residuei310 – 3101Phosphoserine2 Publications
    Modified residuei323 – 3231Phosphoserine1 Publication
    Modified residuei342 – 3421Phosphoserine1 Publication
    Modified residuei383 – 3831PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ02780.
    PaxDbiQ02780.
    PRIDEiQ02780.

    PTM databases

    PhosphoSiteiQ02780.

    Miscellaneous databases

    PMAP-CutDBQ02780.

    Expressioni

    Gene expression databases

    ArrayExpressiQ02780.
    BgeeiQ02780.
    CleanExiMM_NFIA.
    GenevestigatoriQ02780.

    Interactioni

    Subunit structurei

    Binds DNA as a homodimer.

    Protein-protein interaction databases

    IntActiQ02780. 1 interaction.
    MINTiMINT-4103569.

    Structurei

    3D structure databases

    ProteinModelPortaliQ02780.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the CTF/NF-I family.PROSITE-ProRule annotation
    Contains 1 CTF/NF-I DNA-binding domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG252172.
    GeneTreeiENSGT00390000009905.
    HOVERGENiHBG006561.
    InParanoidiQ02780.
    KOiK09168.
    OMAiKEQPENG.
    PhylomeDBiQ02780.
    TreeFamiTF313889.

    Family and domain databases

    InterProiIPR000647. CTF/NFI.
    IPR020604. CTF/NFI_DNA-bd-dom.
    IPR019739. CTF/NFI_DNA-bd_CS.
    IPR019548. CTF/NFI_DNA-bd_N.
    IPR003619. MAD_homology1_Dwarfin-type.
    [Graphical view]
    PANTHERiPTHR11492. PTHR11492. 1 hit.
    PfamiPF00859. CTF_NFI. 1 hit.
    PF03165. MH1. 1 hit.
    PF10524. NfI_DNAbd_pre-N. 1 hit.
    [Graphical view]
    SMARTiSM00523. DWA. 1 hit.
    [Graphical view]
    PROSITEiPS00349. CTF_NFI_1. 1 hit.
    PS51080. CTF_NFI_2. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 2 (identifier: Q02780-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKLADSVMAG KASDGSIKWQ LCYDISARTW WMDEFHPFIE ALLPHVRAFA    50
    YTWFNLQARK RKYFKKHEKR MSKEEERAVK DELLSEKPEV KQKWASRLLA 100
    KLRKDIRPEY REDFVLTVTG KKPPCCVLSN PDQKGKMRRI DCLRQADKVW 150
    RLDLVMVILF KGIPLESTDG ERLVKSPQCS NPGLCVQPHH IGVSVKELDL 200
    YLAYFVHAAD SSQSESPSQP SEADIKDQPE NGHLGFQDSF VTSGVFSVTE 250
    LVRVSQTPIA AGTGPNFSLS DLESSSYYSM SPGAMRRSLP STSSTSSTKR 300
    LKSVEDEMDS PGEEPFYTGQ GRSPGSGSQS SGWHEVEPGL PSPSTLKKSE 350
    KSGFSSPSPS QTSSLGTAFT QHHRPVITGP RASPHATPST LHFPTSPIIQ 400
    QPGPYFSHPA IRYHPQETLK EFVQLVCPDA GQQAGQVGFL NPNGSSQGKV 450
    HNPFLPTPML PPPPPPPMAR PVPLPMPDTK PPTTSTEGGA ASPTSPTYST 500
    PSTSPANRFV SVGPRDPSFV NIPQQTQSWY LG 532
    Length:532
    Mass (Da):58,553
    Last modified:November 1, 1996 - v1
    Checksum:i3AECEEDCD65D28B3
    GO
    Isoform 1 (identifier: Q02780-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ
         476-532: Missing.

    Show »
    Length:452
    Mass (Da):49,978
    Checksum:i0A60CD21134D916D
    GO
    Isoform 3 (identifier: Q02780-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-31: Missing.

    Show »
    Length:501
    Mass (Da):55,052
    Checksum:i253D52DC51479989
    GO
    Isoform 4 (identifier: Q02780-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → VWFQQPLPFADLLPGNSIHTASPTCLTQ

    Note: Incomplete sequence.

    Show »
    Length:528
    Mass (Da):57,985
    Checksum:i246B72B15F8C49F6
    GO
    Isoform 5 (identifier: Q02780-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ
         339-381: Missing.

    Note: Incomplete sequence.

    Show »
    Length:466
    Mass (Da):51,497
    Checksum:iCC9057763FE44CD3
    GO
    Isoform 6 (identifier: Q02780-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → LSPPLSPSRTHTHAHLQPAHRRARTPRRPAVMYSPLCLTQ
         340-370: LPSPSTLKKSEKSGFSSPSPSQTSSLGTAFT → EQSHKREGNGVCVWLCCHGRVVESSRYNGSA
         371-532: Missing.

    Note: Incomplete sequence.

    Show »
    Length:378
    Mass (Da):42,408
    Checksum:iC6B7E8EB9DE5378A
    GO
    Isoform 7 (identifier: Q02780-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ

    Show »
    Length:509
    Mass (Da):55,958
    Checksum:iE029E97576C19C55
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3232MKLAD…RTWWM → MYSPLCLTQ in isoform 1, isoform 5 and isoform 7. 3 PublicationsVSP_003537Add
    BLAST
    Alternative sequencei1 – 3232MKLAD…RTWWM → VWFQQPLPFADLLPGNSIHT ASPTCLTQ in isoform 4. 1 PublicationVSP_003539Add
    BLAST
    Alternative sequencei1 – 3232MKLAD…RTWWM → LSPPLSPSRTHTHAHLQPAH RRARTPRRPAVMYSPLCLTQ in isoform 6. CuratedVSP_003540Add
    BLAST
    Alternative sequencei1 – 3131Missing in isoform 3. 1 PublicationVSP_003538Add
    BLAST
    Alternative sequencei339 – 38143Missing in isoform 5. CuratedVSP_003541Add
    BLAST
    Alternative sequencei340 – 37031LPSPS…GTAFT → EQSHKREGNGVCVWLCCHGR VVESSRYNGSA in isoform 6. CuratedVSP_003542Add
    BLAST
    Alternative sequencei371 – 532162Missing in isoform 6. CuratedVSP_003543Add
    BLAST
    Alternative sequencei476 – 53257Missing in isoform 1. 2 PublicationsVSP_003544Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D90172 mRNA. Translation: BAA20909.1.
    D90173 mRNA. Translation: BAA14203.1.
    D90174 mRNA. Translation: BAA14204.1.
    D90175 mRNA. Translation: BAA14205.1.
    D90176 mRNA. Translation: BAA14206.1.
    AF326554 mRNA. Translation: AAL37400.1.
    AF326553 mRNA. Translation: AAL37399.1.
    Y07690 mRNA. Translation: CAA68954.1.
    Y07691 mRNA. Translation: CAA68955.1.
    AK137731 mRNA. Translation: BAE23481.1.
    AK052204 mRNA. Translation: BAC34883.1.
    U57633 mRNA. Translation: AAB49928.1.
    AF111263 Genomic DNA. Translation: AAD39098.1.
    CCDSiCCDS18373.1. [Q02780-7]
    CCDS51234.1. [Q02780-5]
    PIRiB36596.
    RefSeqiNP_001116424.1. NM_001122952.1. [Q02780-1]
    NP_001116425.1. NM_001122953.1. [Q02780-5]
    NP_035035.1. NM_010905.3. [Q02780-7]
    XP_006502905.1. XM_006502842.1. [Q02780-3]
    UniGeneiMm.31274.
    Mm.409646.

    Genome annotation databases

    EnsembliENSMUST00000075448; ENSMUSP00000074899; ENSMUSG00000028565. [Q02780-7]
    ENSMUST00000092532; ENSMUSP00000130032; ENSMUSG00000028565. [Q02780-5]
    GeneIDi18027.
    KEGGimmu:18027.
    UCSCiuc008tts.2. mouse. [Q02780-1]
    uc008ttt.2. mouse. [Q02780-6]
    uc008ttv.2. mouse. [Q02780-5]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D90172 mRNA. Translation: BAA20909.1 .
    D90173 mRNA. Translation: BAA14203.1 .
    D90174 mRNA. Translation: BAA14204.1 .
    D90175 mRNA. Translation: BAA14205.1 .
    D90176 mRNA. Translation: BAA14206.1 .
    AF326554 mRNA. Translation: AAL37400.1 .
    AF326553 mRNA. Translation: AAL37399.1 .
    Y07690 mRNA. Translation: CAA68954.1 .
    Y07691 mRNA. Translation: CAA68955.1 .
    AK137731 mRNA. Translation: BAE23481.1 .
    AK052204 mRNA. Translation: BAC34883.1 .
    U57633 mRNA. Translation: AAB49928.1 .
    AF111263 Genomic DNA. Translation: AAD39098.1 .
    CCDSi CCDS18373.1. [Q02780-7 ]
    CCDS51234.1. [Q02780-5 ]
    PIRi B36596.
    RefSeqi NP_001116424.1. NM_001122952.1. [Q02780-1 ]
    NP_001116425.1. NM_001122953.1. [Q02780-5 ]
    NP_035035.1. NM_010905.3. [Q02780-7 ]
    XP_006502905.1. XM_006502842.1. [Q02780-3 ]
    UniGenei Mm.31274.
    Mm.409646.

    3D structure databases

    ProteinModelPortali Q02780.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q02780. 1 interaction.
    MINTi MINT-4103569.

    PTM databases

    PhosphoSitei Q02780.

    Proteomic databases

    MaxQBi Q02780.
    PaxDbi Q02780.
    PRIDEi Q02780.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000075448 ; ENSMUSP00000074899 ; ENSMUSG00000028565 . [Q02780-7 ]
    ENSMUST00000092532 ; ENSMUSP00000130032 ; ENSMUSG00000028565 . [Q02780-5 ]
    GeneIDi 18027.
    KEGGi mmu:18027.
    UCSCi uc008tts.2. mouse. [Q02780-1 ]
    uc008ttt.2. mouse. [Q02780-6 ]
    uc008ttv.2. mouse. [Q02780-5 ]

    Organism-specific databases

    CTDi 4774.
    MGIi MGI:108056. Nfia.

    Phylogenomic databases

    eggNOGi NOG252172.
    GeneTreei ENSGT00390000009905.
    HOVERGENi HBG006561.
    InParanoidi Q02780.
    KOi K09168.
    OMAi KEQPENG.
    PhylomeDBi Q02780.
    TreeFami TF313889.

    Enzyme and pathway databases

    Reactomei REACT_221403. RNA Polymerase III Transcription Termination.

    Miscellaneous databases

    NextBioi 293095.
    PMAP-CutDB Q02780.
    PROi Q02780.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q02780.
    Bgeei Q02780.
    CleanExi MM_NFIA.
    Genevestigatori Q02780.

    Family and domain databases

    InterProi IPR000647. CTF/NFI.
    IPR020604. CTF/NFI_DNA-bd-dom.
    IPR019739. CTF/NFI_DNA-bd_CS.
    IPR019548. CTF/NFI_DNA-bd_N.
    IPR003619. MAD_homology1_Dwarfin-type.
    [Graphical view ]
    PANTHERi PTHR11492. PTHR11492. 1 hit.
    Pfami PF00859. CTF_NFI. 1 hit.
    PF03165. MH1. 1 hit.
    PF10524. NfI_DNAbd_pre-N. 1 hit.
    [Graphical view ]
    SMARTi SM00523. DWA. 1 hit.
    [Graphical view ]
    PROSITEi PS00349. CTF_NFI_1. 1 hit.
    PS51080. CTF_NFI_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation of complementary DNAs encoding a cerebellum-enriched nuclear factor I family that activates transcription from the mouse myelin basic protein promoter."
      Inoue T., Tamura T.A., Furuichi T., Mikoshiba K.
      J. Biol. Chem. 265:19065-19070(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), PARTIAL NUCLEOTIDE SEQUENCE (ISOFORM 6).
      Tissue: Brain.
    2. "Congenic mapping of alcohol and pentobarbital withdrawal liability loci to a <1 centimorgan interval of murine chromosome 4: identification of Mpdz as a candidate gene."
      Fehr C., Shirley R.L., Belknap J.K., Crabbe J.C., Buck K.J.
      J. Neurosci. 22:3730-3738(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 7).
      Strain: C57BL/6J and DBA/2J.
      Tissue: Brain.
    3. "Genomic organization, splice products and mouse chromosomal localization of genes for transcription factor Nuclear Factor One."
      Gruender A., Qian F., Ebel T.T., Mincheva A., Lichter P., Kruse U., Sippel A.E.
      Gene 304:171-181(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1 AND 5).
      Strain: NIH Swiss.
      Tissue: Embryo.
    4. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
      Strain: C57BL/6J.
      Tissue: Vagina.
    5. "Expression patterns of the four nuclear factor I genes during mouse embryogenesis indicate a potential role in development."
      Chaudhry A.Z., Lyons G.E., Gronostajski R.M.
      Dev. Dyn. 208:313-325(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2-509 (ISOFORM 1).
      Strain: BALB/c.
    6. "Exon structure of the nuclear factor I DNA-binding domain from C. elegans to mammals."
      Fletcher C.F., Jenkins N.A., Copeland N.G., Chaudhry A.Z., Gronostajski R.M.
      Mamm. Genome 10:390-396(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 33-209.
      Strain: 129.
    7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-310, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic brain.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-303; SER-310; SER-323 AND SER-342, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.

    Entry informationi

    Entry nameiNFIA_MOUSE
    AccessioniPrimary (citable) accession number: Q02780
    Secondary accession number(s): P70250
    , P70251, Q3UUZ2, Q61960, Q8VBT5, Q9R1G5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 2001
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 136 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3