Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear factor 1 A-type

Gene

Nfia

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi24 – 217CTF/NF-IPROSITE-ProRule annotationAdd BLAST194

GO - Molecular functioni

GO - Biological processi

  • DNA replication Source: UniProtKB-KW
  • negative regulation of transcription from RNA polymerase II promoter Source: GO_Central
  • positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • synapse maturation Source: MGI
  • ureter development Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

DNA replication, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor 1 A-type
Short name:
NF1-A
Short name:
Nuclear factor 1/A
Alternative name(s):
CCAAT-box-binding transcription factor
Short name:
CTF
Nuclear factor I/A
Short name:
NF-I/A
Short name:
NFI-A
TGGCA-binding protein
Gene namesi
Name:Nfia
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:108056. Nfia.

Subcellular locationi

GO - Cellular componenti

  • cell junction Source: MGI
  • nucleoplasm Source: MGI
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001001921 – 532Nuclear factor 1 A-typeAdd BLAST532

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei281PhosphoserineBy similarity1
Modified residuei288PhosphoserineBy similarity1
Modified residuei303PhosphoserineCombined sources1
Modified residuei310PhosphoserineCombined sources1
Modified residuei323PhosphoserineCombined sources1
Modified residuei328PhosphoserineBy similarity1
Modified residuei342PhosphoserineCombined sources1
Modified residuei383PhosphoserineBy similarity1
Modified residuei412Asymmetric dimethylarginineCombined sources1
Modified residuei492PhosphoserineBy similarity1
Modified residuei494PhosphothreonineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

MaxQBiQ02780.
PaxDbiQ02780.
PeptideAtlasiQ02780.
PRIDEiQ02780.

PTM databases

iPTMnetiQ02780.
PhosphoSitePlusiQ02780.

Miscellaneous databases

PMAP-CutDBQ02780.

Expressioni

Gene expression databases

BgeeiENSMUSG00000028565.
CleanExiMM_NFIA.
ExpressionAtlasiQ02780. baseline and differential.
GenevisibleiQ02780. MM.

Interactioni

Subunit structurei

Binds DNA as a homodimer.

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ02780. 1 interactor.
MINTiMINT-4103569.
STRINGi10090.ENSMUSP00000074899.

Structurei

3D structure databases

ProteinModelPortaliQ02780.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CTF/NF-I family.PROSITE-ProRule annotation
Contains 1 CTF/NF-I DNA-binding domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3663. Eukaryota.
ENOG410Y16G. LUCA.
GeneTreeiENSGT00390000009905.
HOVERGENiHBG006561.
InParanoidiQ02780.
KOiK09168.
OMAiAFTHHHR.
OrthoDBiEOG091G0HVY.
PhylomeDBiQ02780.
TreeFamiTF313889.

Family and domain databases

InterProiIPR000647. CTF/NFI.
IPR020604. CTF/NFI_DNA-bd-dom.
IPR019739. CTF/NFI_DNA-bd_CS.
IPR019548. CTF/NFI_DNA-bd_N.
IPR003619. MAD_homology1_Dwarfin-type.
[Graphical view]
PANTHERiPTHR11492. PTHR11492. 1 hit.
PfamiPF00859. CTF_NFI. 1 hit.
PF03165. MH1. 1 hit.
PF10524. NfI_DNAbd_pre-N. 1 hit.
[Graphical view]
SMARTiSM00523. DWA. 1 hit.
[Graphical view]
PROSITEiPS00349. CTF_NFI_1. 1 hit.
PS51080. CTF_NFI_2. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q02780-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKLADSVMAG KASDGSIKWQ LCYDISARTW WMDEFHPFIE ALLPHVRAFA
60 70 80 90 100
YTWFNLQARK RKYFKKHEKR MSKEEERAVK DELLSEKPEV KQKWASRLLA
110 120 130 140 150
KLRKDIRPEY REDFVLTVTG KKPPCCVLSN PDQKGKMRRI DCLRQADKVW
160 170 180 190 200
RLDLVMVILF KGIPLESTDG ERLVKSPQCS NPGLCVQPHH IGVSVKELDL
210 220 230 240 250
YLAYFVHAAD SSQSESPSQP SEADIKDQPE NGHLGFQDSF VTSGVFSVTE
260 270 280 290 300
LVRVSQTPIA AGTGPNFSLS DLESSSYYSM SPGAMRRSLP STSSTSSTKR
310 320 330 340 350
LKSVEDEMDS PGEEPFYTGQ GRSPGSGSQS SGWHEVEPGL PSPSTLKKSE
360 370 380 390 400
KSGFSSPSPS QTSSLGTAFT QHHRPVITGP RASPHATPST LHFPTSPIIQ
410 420 430 440 450
QPGPYFSHPA IRYHPQETLK EFVQLVCPDA GQQAGQVGFL NPNGSSQGKV
460 470 480 490 500
HNPFLPTPML PPPPPPPMAR PVPLPMPDTK PPTTSTEGGA ASPTSPTYST
510 520 530
PSTSPANRFV SVGPRDPSFV NIPQQTQSWY LG
Length:532
Mass (Da):58,553
Last modified:November 1, 1996 - v1
Checksum:i3AECEEDCD65D28B3
GO
Isoform 1 (identifier: Q02780-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ
     476-532: Missing.

Show »
Length:452
Mass (Da):49,978
Checksum:i0A60CD21134D916D
GO
Isoform 3 (identifier: Q02780-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.

Show »
Length:501
Mass (Da):55,052
Checksum:i253D52DC51479989
GO
Isoform 4 (identifier: Q02780-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → VWFQQPLPFADLLPGNSIHTASPTCLTQ

Note: Incomplete sequence.
Show »
Length:528
Mass (Da):57,985
Checksum:i246B72B15F8C49F6
GO
Isoform 5 (identifier: Q02780-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ
     339-381: Missing.

Note: Incomplete sequence.
Show »
Length:466
Mass (Da):51,497
Checksum:iCC9057763FE44CD3
GO
Isoform 6 (identifier: Q02780-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → LSPPLSPSRTHTHAHLQPAHRRARTPRRPAVMYSPLCLTQ
     340-370: LPSPSTLKKSEKSGFSSPSPSQTSSLGTAFT → EQSHKREGNGVCVWLCCHGRVVESSRYNGSA
     371-532: Missing.

Note: Incomplete sequence.
Show »
Length:378
Mass (Da):42,408
Checksum:iC6B7E8EB9DE5378A
GO
Isoform 7 (identifier: Q02780-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ

Show »
Length:509
Mass (Da):55,958
Checksum:iE029E97576C19C55
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0035371 – 32MKLAD…RTWWM → MYSPLCLTQ in isoform 1, isoform 5 and isoform 7. 3 PublicationsAdd BLAST32
Alternative sequenceiVSP_0035391 – 32MKLAD…RTWWM → VWFQQPLPFADLLPGNSIHT ASPTCLTQ in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0035401 – 32MKLAD…RTWWM → LSPPLSPSRTHTHAHLQPAH RRARTPRRPAVMYSPLCLTQ in isoform 6. CuratedAdd BLAST32
Alternative sequenceiVSP_0035381 – 31Missing in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_003541339 – 381Missing in isoform 5. CuratedAdd BLAST43
Alternative sequenceiVSP_003542340 – 370LPSPS…GTAFT → EQSHKREGNGVCVWLCCHGR VVESSRYNGSA in isoform 6. CuratedAdd BLAST31
Alternative sequenceiVSP_003543371 – 532Missing in isoform 6. CuratedAdd BLAST162
Alternative sequenceiVSP_003544476 – 532Missing in isoform 1. 2 PublicationsAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90172 mRNA. Translation: BAA20909.1.
D90173 mRNA. Translation: BAA14203.1.
D90174 mRNA. Translation: BAA14204.1.
D90175 mRNA. Translation: BAA14205.1.
D90176 mRNA. Translation: BAA14206.1.
AF326554 mRNA. Translation: AAL37400.1.
AF326553 mRNA. Translation: AAL37399.1.
Y07690 mRNA. Translation: CAA68954.1.
Y07691 mRNA. Translation: CAA68955.1.
AK137731 mRNA. Translation: BAE23481.1.
AK052204 mRNA. Translation: BAC34883.1.
U57633 mRNA. Translation: AAB49928.1.
AF111263 Genomic DNA. Translation: AAD39098.1.
CCDSiCCDS18373.1. [Q02780-7]
CCDS51234.1. [Q02780-5]
PIRiB36596.
RefSeqiNP_001116424.1. NM_001122952.1. [Q02780-1]
NP_001116425.1. NM_001122953.1. [Q02780-5]
NP_035035.1. NM_010905.3. [Q02780-7]
XP_006502905.1. XM_006502842.3. [Q02780-3]
UniGeneiMm.31274.
Mm.409646.

Genome annotation databases

EnsembliENSMUST00000075448; ENSMUSP00000074899; ENSMUSG00000028565. [Q02780-7]
ENSMUST00000092532; ENSMUSP00000130032; ENSMUSG00000028565. [Q02780-5]
GeneIDi18027.
KEGGimmu:18027.
UCSCiuc008tts.2. mouse. [Q02780-1]
uc008ttt.2. mouse. [Q02780-6]
uc008ttu.2. mouse. [Q02780-7]
uc008ttv.2. mouse. [Q02780-5]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90172 mRNA. Translation: BAA20909.1.
D90173 mRNA. Translation: BAA14203.1.
D90174 mRNA. Translation: BAA14204.1.
D90175 mRNA. Translation: BAA14205.1.
D90176 mRNA. Translation: BAA14206.1.
AF326554 mRNA. Translation: AAL37400.1.
AF326553 mRNA. Translation: AAL37399.1.
Y07690 mRNA. Translation: CAA68954.1.
Y07691 mRNA. Translation: CAA68955.1.
AK137731 mRNA. Translation: BAE23481.1.
AK052204 mRNA. Translation: BAC34883.1.
U57633 mRNA. Translation: AAB49928.1.
AF111263 Genomic DNA. Translation: AAD39098.1.
CCDSiCCDS18373.1. [Q02780-7]
CCDS51234.1. [Q02780-5]
PIRiB36596.
RefSeqiNP_001116424.1. NM_001122952.1. [Q02780-1]
NP_001116425.1. NM_001122953.1. [Q02780-5]
NP_035035.1. NM_010905.3. [Q02780-7]
XP_006502905.1. XM_006502842.3. [Q02780-3]
UniGeneiMm.31274.
Mm.409646.

3D structure databases

ProteinModelPortaliQ02780.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ02780. 1 interactor.
MINTiMINT-4103569.
STRINGi10090.ENSMUSP00000074899.

PTM databases

iPTMnetiQ02780.
PhosphoSitePlusiQ02780.

Proteomic databases

MaxQBiQ02780.
PaxDbiQ02780.
PeptideAtlasiQ02780.
PRIDEiQ02780.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000075448; ENSMUSP00000074899; ENSMUSG00000028565. [Q02780-7]
ENSMUST00000092532; ENSMUSP00000130032; ENSMUSG00000028565. [Q02780-5]
GeneIDi18027.
KEGGimmu:18027.
UCSCiuc008tts.2. mouse. [Q02780-1]
uc008ttt.2. mouse. [Q02780-6]
uc008ttu.2. mouse. [Q02780-7]
uc008ttv.2. mouse. [Q02780-5]

Organism-specific databases

CTDi4774.
MGIiMGI:108056. Nfia.

Phylogenomic databases

eggNOGiKOG3663. Eukaryota.
ENOG410Y16G. LUCA.
GeneTreeiENSGT00390000009905.
HOVERGENiHBG006561.
InParanoidiQ02780.
KOiK09168.
OMAiAFTHHHR.
OrthoDBiEOG091G0HVY.
PhylomeDBiQ02780.
TreeFamiTF313889.

Miscellaneous databases

ChiTaRSiNfia. mouse.
PMAP-CutDBQ02780.
PROiQ02780.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000028565.
CleanExiMM_NFIA.
ExpressionAtlasiQ02780. baseline and differential.
GenevisibleiQ02780. MM.

Family and domain databases

InterProiIPR000647. CTF/NFI.
IPR020604. CTF/NFI_DNA-bd-dom.
IPR019739. CTF/NFI_DNA-bd_CS.
IPR019548. CTF/NFI_DNA-bd_N.
IPR003619. MAD_homology1_Dwarfin-type.
[Graphical view]
PANTHERiPTHR11492. PTHR11492. 1 hit.
PfamiPF00859. CTF_NFI. 1 hit.
PF03165. MH1. 1 hit.
PF10524. NfI_DNAbd_pre-N. 1 hit.
[Graphical view]
SMARTiSM00523. DWA. 1 hit.
[Graphical view]
PROSITEiPS00349. CTF_NFI_1. 1 hit.
PS51080. CTF_NFI_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNFIA_MOUSE
AccessioniPrimary (citable) accession number: Q02780
Secondary accession number(s): P70250
, P70251, Q3UUZ2, Q61960, Q8VBT5, Q9R1G5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: November 1, 1996
Last modified: November 2, 2016
This is version 156 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.