SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q02780

- NFIA_MOUSE

UniProt

Q02780 - NFIA_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Nuclear factor 1 A-type
Gene
Nfia
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi24 – 217194CTF/NF-I
Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: MGI
  2. sequence-specific DNA binding transcription factor activity Source: InterPro

GO - Biological processi

  1. DNA replication Source: UniProtKB-KW
  2. positive regulation of transcription from RNA polymerase II promoter Source: MGI
  3. response to organic cyclic compound Source: Ensembl
  4. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

DNA replication, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiREACT_221403. RNA Polymerase III Transcription Termination.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor 1 A-type
Short name:
NF1-A
Short name:
Nuclear factor 1/A
Alternative name(s):
CCAAT-box-binding transcription factor
Short name:
CTF
Nuclear factor I/A
Short name:
NF-I/A
Short name:
NFI-A
TGGCA-binding protein
Gene namesi
Name:Nfia
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 4

Organism-specific databases

MGIiMGI:108056. Nfia.

Subcellular locationi

GO - Cellular componenti

  1. cell junction Source: Ensembl
  2. nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 532532Nuclear factor 1 A-type
PRO_0000100192Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei281 – 2811Phosphoserine By similarity
Modified residuei288 – 2881Phosphoserine By similarity
Modified residuei303 – 3031Phosphoserine1 Publication
Modified residuei310 – 3101Phosphoserine2 Publications
Modified residuei323 – 3231Phosphoserine1 Publication
Modified residuei342 – 3421Phosphoserine1 Publication
Modified residuei383 – 3831Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ02780.
PaxDbiQ02780.
PRIDEiQ02780.

PTM databases

PhosphoSiteiQ02780.

Miscellaneous databases

PMAP-CutDBQ02780.

Expressioni

Gene expression databases

ArrayExpressiQ02780.
BgeeiQ02780.
CleanExiMM_NFIA.
GenevestigatoriQ02780.

Interactioni

Subunit structurei

Binds DNA as a homodimer.

Protein-protein interaction databases

IntActiQ02780. 1 interaction.
MINTiMINT-4103569.

Structurei

3D structure databases

ProteinModelPortaliQ02780.

Family & Domainsi

Sequence similaritiesi

Belongs to the CTF/NF-I family.

Phylogenomic databases

eggNOGiNOG252172.
GeneTreeiENSGT00390000009905.
HOVERGENiHBG006561.
InParanoidiQ02780.
KOiK09168.
OMAiKEQPENG.
PhylomeDBiQ02780.
TreeFamiTF313889.

Family and domain databases

InterProiIPR000647. CTF/NFI.
IPR020604. CTF/NFI_DNA-bd-dom.
IPR019739. CTF/NFI_DNA-bd_CS.
IPR019548. CTF/NFI_DNA-bd_N.
IPR003619. MAD_homology1_Dwarfin-type.
[Graphical view]
PANTHERiPTHR11492. PTHR11492. 1 hit.
PfamiPF00859. CTF_NFI. 1 hit.
PF03165. MH1. 1 hit.
PF10524. NfI_DNAbd_pre-N. 1 hit.
[Graphical view]
SMARTiSM00523. DWA. 1 hit.
[Graphical view]
PROSITEiPS00349. CTF_NFI_1. 1 hit.
PS51080. CTF_NFI_2. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 2 (identifier: Q02780-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKLADSVMAG KASDGSIKWQ LCYDISARTW WMDEFHPFIE ALLPHVRAFA    50
YTWFNLQARK RKYFKKHEKR MSKEEERAVK DELLSEKPEV KQKWASRLLA 100
KLRKDIRPEY REDFVLTVTG KKPPCCVLSN PDQKGKMRRI DCLRQADKVW 150
RLDLVMVILF KGIPLESTDG ERLVKSPQCS NPGLCVQPHH IGVSVKELDL 200
YLAYFVHAAD SSQSESPSQP SEADIKDQPE NGHLGFQDSF VTSGVFSVTE 250
LVRVSQTPIA AGTGPNFSLS DLESSSYYSM SPGAMRRSLP STSSTSSTKR 300
LKSVEDEMDS PGEEPFYTGQ GRSPGSGSQS SGWHEVEPGL PSPSTLKKSE 350
KSGFSSPSPS QTSSLGTAFT QHHRPVITGP RASPHATPST LHFPTSPIIQ 400
QPGPYFSHPA IRYHPQETLK EFVQLVCPDA GQQAGQVGFL NPNGSSQGKV 450
HNPFLPTPML PPPPPPPMAR PVPLPMPDTK PPTTSTEGGA ASPTSPTYST 500
PSTSPANRFV SVGPRDPSFV NIPQQTQSWY LG 532
Length:532
Mass (Da):58,553
Last modified:November 1, 1996 - v1
Checksum:i3AECEEDCD65D28B3
GO
Isoform 1 (identifier: Q02780-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ
     476-532: Missing.

Show »
Length:452
Mass (Da):49,978
Checksum:i0A60CD21134D916D
GO
Isoform 3 (identifier: Q02780-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.

Show »
Length:501
Mass (Da):55,052
Checksum:i253D52DC51479989
GO
Isoform 4 (identifier: Q02780-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → VWFQQPLPFADLLPGNSIHTASPTCLTQ

Note: Incomplete sequence.

Show »
Length:528
Mass (Da):57,985
Checksum:i246B72B15F8C49F6
GO
Isoform 5 (identifier: Q02780-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ
     339-381: Missing.

Note: Incomplete sequence.

Show »
Length:466
Mass (Da):51,497
Checksum:iCC9057763FE44CD3
GO
Isoform 6 (identifier: Q02780-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → LSPPLSPSRTHTHAHLQPAHRRARTPRRPAVMYSPLCLTQ
     340-370: LPSPSTLKKSEKSGFSSPSPSQTSSLGTAFT → EQSHKREGNGVCVWLCCHGRVVESSRYNGSA
     371-532: Missing.

Note: Incomplete sequence.

Show »
Length:378
Mass (Da):42,408
Checksum:iC6B7E8EB9DE5378A
GO
Isoform 7 (identifier: Q02780-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKLADSVMAGKASDGSIKWQLCYDISARTWWM → MYSPLCLTQ

Show »
Length:509
Mass (Da):55,958
Checksum:iE029E97576C19C55
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3232MKLAD…RTWWM → MYSPLCLTQ in isoform 1, isoform 5 and isoform 7.
VSP_003537Add
BLAST
Alternative sequencei1 – 3232MKLAD…RTWWM → VWFQQPLPFADLLPGNSIHT ASPTCLTQ in isoform 4.
VSP_003539Add
BLAST
Alternative sequencei1 – 3232MKLAD…RTWWM → LSPPLSPSRTHTHAHLQPAH RRARTPRRPAVMYSPLCLTQ in isoform 6.
VSP_003540Add
BLAST
Alternative sequencei1 – 3131Missing in isoform 3.
VSP_003538Add
BLAST
Alternative sequencei339 – 38143Missing in isoform 5.
VSP_003541Add
BLAST
Alternative sequencei340 – 37031LPSPS…GTAFT → EQSHKREGNGVCVWLCCHGR VVESSRYNGSA in isoform 6.
VSP_003542Add
BLAST
Alternative sequencei371 – 532162Missing in isoform 6.
VSP_003543Add
BLAST
Alternative sequencei476 – 53257Missing in isoform 1.
VSP_003544Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D90172 mRNA. Translation: BAA20909.1.
D90173 mRNA. Translation: BAA14203.1.
D90174 mRNA. Translation: BAA14204.1.
D90175 mRNA. Translation: BAA14205.1.
D90176 mRNA. Translation: BAA14206.1.
AF326554 mRNA. Translation: AAL37400.1.
AF326553 mRNA. Translation: AAL37399.1.
Y07690 mRNA. Translation: CAA68954.1.
Y07691 mRNA. Translation: CAA68955.1.
AK137731 mRNA. Translation: BAE23481.1.
AK052204 mRNA. Translation: BAC34883.1.
U57633 mRNA. Translation: AAB49928.1.
AF111263 Genomic DNA. Translation: AAD39098.1.
CCDSiCCDS18373.1. [Q02780-7]
CCDS51234.1. [Q02780-5]
PIRiB36596.
RefSeqiNP_001116424.1. NM_001122952.1. [Q02780-1]
NP_001116425.1. NM_001122953.1. [Q02780-5]
NP_035035.1. NM_010905.3. [Q02780-7]
XP_006502905.1. XM_006502842.1. [Q02780-3]
UniGeneiMm.31274.
Mm.409646.

Genome annotation databases

EnsembliENSMUST00000075448; ENSMUSP00000074899; ENSMUSG00000028565. [Q02780-7]
ENSMUST00000092532; ENSMUSP00000130032; ENSMUSG00000028565. [Q02780-5]
GeneIDi18027.
KEGGimmu:18027.
UCSCiuc008tts.2. mouse. [Q02780-1]
uc008ttt.2. mouse. [Q02780-6]
uc008ttv.2. mouse. [Q02780-5]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D90172 mRNA. Translation: BAA20909.1 .
D90173 mRNA. Translation: BAA14203.1 .
D90174 mRNA. Translation: BAA14204.1 .
D90175 mRNA. Translation: BAA14205.1 .
D90176 mRNA. Translation: BAA14206.1 .
AF326554 mRNA. Translation: AAL37400.1 .
AF326553 mRNA. Translation: AAL37399.1 .
Y07690 mRNA. Translation: CAA68954.1 .
Y07691 mRNA. Translation: CAA68955.1 .
AK137731 mRNA. Translation: BAE23481.1 .
AK052204 mRNA. Translation: BAC34883.1 .
U57633 mRNA. Translation: AAB49928.1 .
AF111263 Genomic DNA. Translation: AAD39098.1 .
CCDSi CCDS18373.1. [Q02780-7 ]
CCDS51234.1. [Q02780-5 ]
PIRi B36596.
RefSeqi NP_001116424.1. NM_001122952.1. [Q02780-1 ]
NP_001116425.1. NM_001122953.1. [Q02780-5 ]
NP_035035.1. NM_010905.3. [Q02780-7 ]
XP_006502905.1. XM_006502842.1. [Q02780-3 ]
UniGenei Mm.31274.
Mm.409646.

3D structure databases

ProteinModelPortali Q02780.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q02780. 1 interaction.
MINTi MINT-4103569.

PTM databases

PhosphoSitei Q02780.

Proteomic databases

MaxQBi Q02780.
PaxDbi Q02780.
PRIDEi Q02780.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000075448 ; ENSMUSP00000074899 ; ENSMUSG00000028565 . [Q02780-7 ]
ENSMUST00000092532 ; ENSMUSP00000130032 ; ENSMUSG00000028565 . [Q02780-5 ]
GeneIDi 18027.
KEGGi mmu:18027.
UCSCi uc008tts.2. mouse. [Q02780-1 ]
uc008ttt.2. mouse. [Q02780-6 ]
uc008ttv.2. mouse. [Q02780-5 ]

Organism-specific databases

CTDi 4774.
MGIi MGI:108056. Nfia.

Phylogenomic databases

eggNOGi NOG252172.
GeneTreei ENSGT00390000009905.
HOVERGENi HBG006561.
InParanoidi Q02780.
KOi K09168.
OMAi KEQPENG.
PhylomeDBi Q02780.
TreeFami TF313889.

Enzyme and pathway databases

Reactomei REACT_221403. RNA Polymerase III Transcription Termination.

Miscellaneous databases

NextBioi 293095.
PMAP-CutDB Q02780.
PROi Q02780.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q02780.
Bgeei Q02780.
CleanExi MM_NFIA.
Genevestigatori Q02780.

Family and domain databases

InterProi IPR000647. CTF/NFI.
IPR020604. CTF/NFI_DNA-bd-dom.
IPR019739. CTF/NFI_DNA-bd_CS.
IPR019548. CTF/NFI_DNA-bd_N.
IPR003619. MAD_homology1_Dwarfin-type.
[Graphical view ]
PANTHERi PTHR11492. PTHR11492. 1 hit.
Pfami PF00859. CTF_NFI. 1 hit.
PF03165. MH1. 1 hit.
PF10524. NfI_DNAbd_pre-N. 1 hit.
[Graphical view ]
SMARTi SM00523. DWA. 1 hit.
[Graphical view ]
PROSITEi PS00349. CTF_NFI_1. 1 hit.
PS51080. CTF_NFI_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation of complementary DNAs encoding a cerebellum-enriched nuclear factor I family that activates transcription from the mouse myelin basic protein promoter."
    Inoue T., Tamura T.A., Furuichi T., Mikoshiba K.
    J. Biol. Chem. 265:19065-19070(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), PARTIAL NUCLEOTIDE SEQUENCE (ISOFORM 6).
    Tissue: Brain.
  2. "Congenic mapping of alcohol and pentobarbital withdrawal liability loci to a <1 centimorgan interval of murine chromosome 4: identification of Mpdz as a candidate gene."
    Fehr C., Shirley R.L., Belknap J.K., Crabbe J.C., Buck K.J.
    J. Neurosci. 22:3730-3738(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 7).
    Strain: C57BL/6J and DBA/2J.
    Tissue: Brain.
  3. "Genomic organization, splice products and mouse chromosomal localization of genes for transcription factor Nuclear Factor One."
    Gruender A., Qian F., Ebel T.T., Mincheva A., Lichter P., Kruse U., Sippel A.E.
    Gene 304:171-181(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1 AND 5).
    Strain: NIH Swiss.
    Tissue: Embryo.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
    Strain: C57BL/6J.
    Tissue: Vagina.
  5. "Expression patterns of the four nuclear factor I genes during mouse embryogenesis indicate a potential role in development."
    Chaudhry A.Z., Lyons G.E., Gronostajski R.M.
    Dev. Dyn. 208:313-325(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2-509 (ISOFORM 1).
    Strain: BALB/c.
  6. "Exon structure of the nuclear factor I DNA-binding domain from C. elegans to mammals."
    Fletcher C.F., Jenkins N.A., Copeland N.G., Chaudhry A.Z., Gronostajski R.M.
    Mamm. Genome 10:390-396(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 33-209.
    Strain: 129.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-310, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic brain.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-303; SER-310; SER-323 AND SER-342, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiNFIA_MOUSE
AccessioniPrimary (citable) accession number: Q02780
Secondary accession number(s): P70250
, P70251, Q3UUZ2, Q61960, Q8VBT5, Q9R1G5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: November 1, 1996
Last modified: September 3, 2014
This is version 135 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi