Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q02641

- CACB1_HUMAN

UniProt

Q02641 - CACB1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Voltage-dependent L-type calcium channel subunit beta-1

Gene

CACNB1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

GO - Molecular functioni

  1. high voltage-gated calcium channel activity Source: Ensembl
  2. voltage-gated calcium channel activity Source: ProtInc

GO - Biological processi

  1. axon guidance Source: Reactome
  2. protein targeting to membrane Source: Ensembl
  3. transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_13606. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.
REACT_18312. NCAM1 interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-1
Short name:
CAB1
Alternative name(s):
Calcium channel voltage-dependent subunit beta 1
Gene namesi
Name:CACNB1
Synonyms:CACNLB1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:1401. CACNB1.

Subcellular locationi

GO - Cellular componenti

  1. sarcoplasmic reticulum Source: Ensembl
  2. T-tubule Source: Ensembl
  3. voltage-gated calcium channel complex Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA87.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 598598Voltage-dependent L-type calcium channel subunit beta-1PRO_0000144046Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei499 – 4991PhosphothreonineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ02641.
PaxDbiQ02641.
PRIDEiQ02641.

PTM databases

PhosphoSiteiQ02641.

Expressioni

Tissue specificityi

Isoform 1 and isoform 3 are expressed in brain, heart, spleen, central nervous system and neuroblastoma cells. Isoform 2 is expressed in skeletal muscle.1 Publication

Gene expression databases

BgeeiQ02641.
CleanExiHS_CACNB1.
ExpressionAtlasiQ02641. baseline and differential.
GenevestigatoriQ02641.

Organism-specific databases

HPAiCAB009779.
HPA023343.

Interactioni

Subunit structurei

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with JSRP1. Interacts with RYR1 (By similarity).By similarity

Protein-protein interaction databases

BioGridi107236. 5 interactions.
IntActiQ02641. 2 interactions.
MINTiMINT-2857287.
STRINGi9606.ENSP00000377840.

Structurei

3D structure databases

ProteinModelPortaliQ02641.
SMRiQ02641. Positions 58-417.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini100 – 16162SH3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiNOG326500.
GeneTreeiENSGT00390000002740.
HOVERGENiHBG050765.
InParanoidiQ02641.
KOiK04862.
OMAiVSNLQVQ.
OrthoDBiEOG7966G4.
PhylomeDBiQ02641.
TreeFamiTF316195.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005443. VDCC_L_b1su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01627. LCACHANNELB1.
SMARTiSM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q02641-1) [UniParc]FASTAAdd to Basket

Also known as: Beta-1b2, BetaA, Beta-1B, Beta1-2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQKTSMSRG PYPPSQEIPM EVFDPSPQGK YSKRKGRFKR SDGSTSSDTT
60 70 80 90 100
SNSFVRQGSA ESYTSRPSDS DVSLEEDREA LRKEAERQAL AQLEKAKTKP
110 120 130 140 150
VAFAVRTNVG YNPSPGDEVP VQGVAITFEP KDFLHIKEKY NNDWWIGRLV
160 170 180 190 200
KEGCEVGFIP SPVKLDSLRL LQEQKLRQNR LGSSKSGDNS SSSLGDVVTG
210 220 230 240 250
TRRPTPPASA KQKQKSTEHV PPYDVVPSMR PIILVGPSLK GYEVTDMMQK
260 270 280 290 300
ALFDFLKHRF DGRISITRVT ADISLAKRSV LNNPSKHIII ERSNTRSSLA
310 320 330 340 350
EVQSEIERIF ELARTLQLVA LDADTINHPA QLSKTSLAPI IVYIKITSPK
360 370 380 390 400
VLQRLIKSRG KSQSKHLNVQ IAASEKLAQC PPEMFDIILD ENQLEDACEH
410 420 430 440 450
LAEYLEAYWK ATHPPSSTPP NPLLNRTMAT AALAASPAPV SNLQGPYLAS
460 470 480 490 500
GDQPLERATG EHASMHEYPG ELGQPPGLYP SSHPPGRAGT LRALSRQDTF
510 520 530 540 550
DADTPGSRNS AYTELGDSCV DMETDPSEGP GLGDPAGGGT PPARQGSWED
560 570 580 590
EEEDYEEELT DNRNRGRNKA RYCAEGGGPV LGRNKNELEG WGRGVYIR
Length:598
Mass (Da):65,714
Last modified:May 2, 2002 - v3
Checksum:i44FE4E3BA6F016FD
GO
Isoform 2 (identifier: Q02641-2) [UniParc]FASTAAdd to Basket

Also known as: Beta-1M, BetaC, Beta-1a

The sequence of this isoform differs from the canonical sequence as follows:
     210-216: AKQKQKS → GNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPPPHGKRIPFFKK
     445-478: GPYLASGDQPLERATGEHASMHEYPGELGQPPGL → VQVLTSLRRNLGFWGGLESSQRGSVVPQEQEHAM
     479-598: Missing.

Show »
Length:523
Mass (Da):57,864
Checksum:i9F8B7C748A65087C
GO
Isoform 3 (identifier: Q02641-3) [UniParc]FASTAAdd to Basket

Also known as: Beta-1b1, BetaB, Beta-1c, Beta1-3

The sequence of this isoform differs from the canonical sequence as follows:
     445-478: GPYLASGDQPLERATGEHASMHEYPGELGQPPGL → VQVLTSLRRNLGFWGGLESSQRGSVVPQEQEHAM
     479-598: Missing.

Show »
Length:478
Mass (Da):53,006
Checksum:i1D0A53AE67443655
GO

Sequence cautioni

The sequence CAA79825.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti5 – 62TS → SG in AAA36167. (PubMed:7916667)Curated
Sequence conflicti21 – 211E → G in AAA51894. (PubMed:1309651)Curated
Sequence conflicti28 – 281Missing in AAA36168. (PubMed:7916667)Curated
Sequence conflicti28 – 281Missing in AAA36169. (PubMed:7916667)Curated
Sequence conflicti29 – 291G → R in AAA36167. (PubMed:7916667)Curated
Sequence conflicti29 – 291G → R in AAA36168. (PubMed:7916667)Curated
Sequence conflicti29 – 291G → R in AAA36169. (PubMed:7916667)Curated
Sequence conflicti135 – 1351H → D in AAA36167. (PubMed:7916667)Curated
Sequence conflicti175 – 1762KL → TV in AAA36167. (PubMed:7916667)Curated
Sequence conflicti182 – 1821G → S in AAA36167. (PubMed:7916667)Curated
Sequence conflicti217 – 2171T → S in AAA36167. (PubMed:7916667)Curated
Sequence conflicti264 – 2641I → T in AAH37311. (PubMed:15489334)Curated
Sequence conflicti293 – 2964SNTR → LQHT in AAA36167. (PubMed:7916667)Curated
Sequence conflicti344 – 3441I → L in AAA36167. (PubMed:7916667)Curated
Sequence conflicti381 – 3811P → H in AAH37311. (PubMed:15489334)Curated
Sequence conflicti428 – 4281M → I in AAA36167. (PubMed:7916667)Curated
Sequence conflicti434 – 4352AA → RR in AAA35631. (PubMed:1385409)Curated
Sequence conflicti434 – 4352AA → RR in AAA35632. (PubMed:1385409)Curated
Sequence conflicti434 – 4352AA → RR in AAA35633. (PubMed:1385409)Curated
Sequence conflicti434 – 4352AA → RR in AAB58779. (PubMed:10624822)Curated
Sequence conflicti434 – 4352AA → RR in AAB58780. (PubMed:10624822)Curated
Sequence conflicti434 – 4352AA → RR in AAB58781. (PubMed:10624822)Curated
Sequence conflicti456 – 4561E → D in AAA36167. (PubMed:7916667)Curated
Sequence conflicti465 – 4651M → V in AAA36167. (PubMed:7916667)Curated
Sequence conflicti482 – 4821S → N in AAA36167. (PubMed:7916667)Curated
Sequence conflicti492 – 4921R → W in AAA36167. (PubMed:7916667)Curated
Sequence conflicti515 – 5151L → P in AAA36167. (PubMed:7916667)Curated
Sequence conflicti532 – 5321L → P in AAA36167. (PubMed:7916667)Curated
Sequence conflicti539 – 5413GTP → A in AAA35633. (PubMed:1385409)Curated
Sequence conflicti539 – 5413GTP → A in AAB58781. (PubMed:10624822)Curated
Sequence conflicti550 – 5501Missing in AAA36167. (PubMed:7916667)Curated
Sequence conflicti559 – 5591L → M in AAA36167. (PubMed:7916667)Curated
Sequence conflicti573 – 5742CA → WP in AAA35633. (PubMed:1385409)Curated
Sequence conflicti573 – 5742CA → WP in AAB58781. (PubMed:10624822)Curated
Sequence conflicti593 – 5931R → Q in AAA36167. (PubMed:7916667)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti339 – 3391P → L in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_036349

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei210 – 2167AKQKQKS → GNEMTNLAFELDPLELEEEE AELGEQSGSAKTSVSSVTTP PPHGKRIPFFKK in isoform 2. 2 PublicationsVSP_000623
Alternative sequencei445 – 47834GPYLA…QPPGL → VQVLTSLRRNLGFWGGLESS QRGSVVPQEQEHAM in isoform 2 and isoform 3. 4 PublicationsVSP_000624Add
BLAST
Alternative sequencei479 – 598120Missing in isoform 2 and isoform 3. 4 PublicationsVSP_000625Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M92303 mRNA. Translation: AAA35633.1.
M92301 mRNA. Translation: AAA35631.1.
M92302 mRNA. Translation: AAA35632.1.
M76560 mRNA. Translation: AAA51894.1.
L06110 mRNA. Translation: AAA36167.1.
L06111 mRNA. Translation: AAA36168.1.
L06112 mRNA. Translation: AAA36169.1.
AB054985 mRNA. Translation: BAB21444.1.
U86960
, U86952, U86953, U86954, U86955, U86956, U86957, U86958, U86959 Genomic DNA. Translation: AAB58779.1.
U86960
, U86952, U86953, U86954, U86955, U86956, U86957, U86958, U86959 Genomic DNA. Translation: AAB58780.1.
U86961
, U86952, U86953, U86954, U86955, U86956, U86957, U86958, U86959, U86960 Genomic DNA. Translation: AAB58781.1. Sequence problems.
AK289729 mRNA. Translation: BAF82418.1.
CH471152 Genomic DNA. Translation: EAW60562.1.
BC037311 mRNA. Translation: AAH37311.2.
Z21725 Genomic DNA. Translation: CAA79824.1.
Z21726 Genomic DNA. Translation: CAA79825.1. Different initiation.
CCDSiCCDS11334.1. [Q02641-2]
CCDS42311.1. [Q02641-1]
CCDS45665.1. [Q02641-3]
PIRiA44461.
B44461.
C44461.
I38002.
I52859.
I65766.
I65767.
JH0566.
RefSeqiNP_000714.3. NM_000723.4. [Q02641-1]
NP_954855.1. NM_199247.2. [Q02641-2]
NP_954856.1. NM_199248.2. [Q02641-3]
UniGeneiHs.635.

Genome annotation databases

EnsembliENST00000344140; ENSP00000345461; ENSG00000067191. [Q02641-2]
ENST00000394303; ENSP00000377840; ENSG00000067191. [Q02641-1]
ENST00000394310; ENSP00000377847; ENSG00000067191. [Q02641-3]
GeneIDi782.
KEGGihsa:782.
UCSCiuc002hrl.1. human. [Q02641-1]
uc002hrn.3. human. [Q02641-3]
uc002hro.3. human. [Q02641-2]

Polymorphism databases

DMDMi20455481.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M92303 mRNA. Translation: AAA35633.1 .
M92301 mRNA. Translation: AAA35631.1 .
M92302 mRNA. Translation: AAA35632.1 .
M76560 mRNA. Translation: AAA51894.1 .
L06110 mRNA. Translation: AAA36167.1 .
L06111 mRNA. Translation: AAA36168.1 .
L06112 mRNA. Translation: AAA36169.1 .
AB054985 mRNA. Translation: BAB21444.1 .
U86960
, U86952 , U86953 , U86954 , U86955 , U86956 , U86957 , U86958 , U86959 Genomic DNA. Translation: AAB58779.1 .
U86960
, U86952 , U86953 , U86954 , U86955 , U86956 , U86957 , U86958 , U86959 Genomic DNA. Translation: AAB58780.1 .
U86961
, U86952 , U86953 , U86954 , U86955 , U86956 , U86957 , U86958 , U86959 , U86960 Genomic DNA. Translation: AAB58781.1 . Sequence problems.
AK289729 mRNA. Translation: BAF82418.1 .
CH471152 Genomic DNA. Translation: EAW60562.1 .
BC037311 mRNA. Translation: AAH37311.2 .
Z21725 Genomic DNA. Translation: CAA79824.1 .
Z21726 Genomic DNA. Translation: CAA79825.1 . Different initiation.
CCDSi CCDS11334.1. [Q02641-2 ]
CCDS42311.1. [Q02641-1 ]
CCDS45665.1. [Q02641-3 ]
PIRi A44461.
B44461.
C44461.
I38002.
I52859.
I65766.
I65767.
JH0566.
RefSeqi NP_000714.3. NM_000723.4. [Q02641-1 ]
NP_954855.1. NM_199247.2. [Q02641-2 ]
NP_954856.1. NM_199248.2. [Q02641-3 ]
UniGenei Hs.635.

3D structure databases

ProteinModelPortali Q02641.
SMRi Q02641. Positions 58-417.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107236. 5 interactions.
IntActi Q02641. 2 interactions.
MINTi MINT-2857287.
STRINGi 9606.ENSP00000377840.

Chemistry

ChEMBLi CHEMBL2363032.
DrugBanki DB04855. Dronedarone.
DB00308. Ibutilide.
DB00653. Magnesium Sulfate.
DB00393. Nimodipine.
DB00421. Spironolactone.
DB00661. Verapamil.

PTM databases

PhosphoSitei Q02641.

Polymorphism databases

DMDMi 20455481.

Proteomic databases

MaxQBi Q02641.
PaxDbi Q02641.
PRIDEi Q02641.

Protocols and materials databases

DNASUi 782.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000344140 ; ENSP00000345461 ; ENSG00000067191 . [Q02641-2 ]
ENST00000394303 ; ENSP00000377840 ; ENSG00000067191 . [Q02641-1 ]
ENST00000394310 ; ENSP00000377847 ; ENSG00000067191 . [Q02641-3 ]
GeneIDi 782.
KEGGi hsa:782.
UCSCi uc002hrl.1. human. [Q02641-1 ]
uc002hrn.3. human. [Q02641-3 ]
uc002hro.3. human. [Q02641-2 ]

Organism-specific databases

CTDi 782.
GeneCardsi GC17M037329.
HGNCi HGNC:1401. CACNB1.
HPAi CAB009779.
HPA023343.
MIMi 114207. gene.
neXtProti NX_Q02641.
PharmGKBi PA87.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG326500.
GeneTreei ENSGT00390000002740.
HOVERGENi HBG050765.
InParanoidi Q02641.
KOi K04862.
OMAi VSNLQVQ.
OrthoDBi EOG7966G4.
PhylomeDBi Q02641.
TreeFami TF316195.

Enzyme and pathway databases

Reactomei REACT_13606. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.
REACT_18312. NCAM1 interactions.

Miscellaneous databases

GeneWikii CACNB1.
GenomeRNAii 782.
NextBioi 3164.
PROi Q02641.
SOURCEi Search...

Gene expression databases

Bgeei Q02641.
CleanExi HS_CACNB1.
ExpressionAtlasi Q02641. baseline and differential.
Genevestigatori Q02641.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005443. VDCC_L_b1su.
IPR000584. VDCC_L_bsu.
[Graphical view ]
PANTHERi PTHR11824. PTHR11824. 1 hit.
Pfami PF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view ]
PRINTSi PR01626. LCACHANNELB.
PR01627. LCACHANNELB1.
SMARTi SM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEi PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Skeletal muscle and brain isoforms of a beta-subunit of human voltage-dependent calcium channels are encoded by a single gene."
    Powers P.A., Liu S., Hogan K., Gregg R.G.
    J. Biol. Chem. 267:22967-22972(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Hippocampus and Skeletal muscle.
  2. "Structure and functional expression of alpha 1, alpha 2, and beta subunits of a novel human neuronal calcium channel subtype."
    Williams M.E., Feldman D.H., McCue A.F., Brenner R., Velicelebi G., Ellis S.B., Harpold M.M.
    Neuron 8:71-84(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  3. "Molecular cloning of three isoforms of the L-type voltage-dependent calcium channel beta subunit from normal human heart."
    Collin T., Wang J., Nargeot J., Schwartz A.
    Circ. Res. 72:1337-1344(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Heart.
  4. "Cyclic AMP-dependent modulation of N- and Q-type Ca2+ channels expressed in Xenopus oocytes."
    Fukuda K., Kaneko S., Yada N., Kikuwaka M., Akaike A., Satoh M.
    Neurosci. Lett. 217:13-16(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain cortex.
  5. "Structure and alternative splicing of the gene encoding the human beta1 subunit of voltage dependent calcium channels."
    Hogan K., Greg R.G., Powers P.A.
    Neurosci. Lett. 277:111-114(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2 AND 3).
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hippocampus.
  9. "Genetic mapping of the beta 1- and gamma-subunits of the human skeletal muscle L-type voltage-dependent calcium channel on chromosome 17q and exclusion as candidate genes for malignant hyperthermia susceptibility."
    Iles D.E., Segers B., Sengers R.C.A., Monsieurs K., Heytens L., Halsall P.J., Hopkins P.M., Ellis F.R., Hall-Curran J.L., Stewart A.D., Wieringa B.
    Hum. Mol. Genet. 2:863-868(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 146-209.
  10. "Human neuronal voltage-dependent calcium channels: studies on subunit structure and role in channel assembly."
    Brust P.F., Simerson S., McCue A.F., Deal C.R., Schoonmaker S., Williams M.E., Velicelebi G., Johnson E.C., Harpold M.M., Ellis S.B.
    Neuropharmacology 32:1089-1102(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 445-598 (ISOFORMS 1 AND 3), TISSUE SPECIFICITY, ALTERNATIVE SPLICING.
  11. Cited for: VARIANT [LARGE SCALE ANALYSIS] LEU-339.

Entry informationi

Entry nameiCACB1_HUMAN
AccessioniPrimary (citable) accession number: Q02641
Secondary accession number(s): A8K114
, O15331, Q02639, Q02640, Q8N3X9, Q9C085, Q9UD79
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: May 2, 2002
Last modified: October 29, 2014
This is version 151 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3