Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit beta-1

Gene

CACNB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

GO - Molecular functioni

  • high voltage-gated calcium channel activity Source: GO_Central
  • voltage-gated calcium channel activity Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium

Enzyme and pathway databases

BioCyciZFISH:ENSG00000067191-MONOMER.
ReactomeiR-HSA-112308. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.
R-HSA-419037. NCAM1 interactions.
R-HSA-5576892. Phase 0 - rapid depolarisation.
R-HSA-5576893. Phase 2 - plateau phase.
R-HSA-5576894. Phase 1 - inactivation of fast Na+ channels.

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-1
Short name:
CAB1
Alternative name(s):
Calcium channel voltage-dependent subunit beta 1
Gene namesi
Name:CACNB1
Synonyms:CACNLB1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:1401. CACNB1.

Subcellular locationi

GO - Cellular componenti

  • plasma membrane Source: Reactome
  • sarcolemma Source: UniProtKB-SubCell
  • voltage-gated calcium channel complex Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi782.
OpenTargetsiENSG00000067191.
PharmGKBiPA87.

Chemistry databases

ChEMBLiCHEMBL2363032.
DrugBankiDB04855. Dronedarone.
DB00898. Ethanol.
DB00308. Ibutilide.
DB00653. Magnesium Sulfate.
DB00393. Nimodipine.
DB00421. Spironolactone.
DB00661. Verapamil.

Polymorphism and mutation databases

BioMutaiCACNB1.
DMDMi20455481.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001440461 – 598Voltage-dependent L-type calcium channel subunit beta-1Add BLAST598

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei44PhosphoserineBy similarity1
Modified residuei47PhosphoserineBy similarity1
Modified residuei73PhosphoserineBy similarity1
Modified residuei186PhosphoserineBy similarity1
Modified residuei193PhosphoserineBy similarity1
Modified residuei499PhosphothreonineBy similarity1
Modified residuei547PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ02641.
PaxDbiQ02641.
PeptideAtlasiQ02641.
PRIDEiQ02641.

PTM databases

iPTMnetiQ02641.
PhosphoSitePlusiQ02641.

Expressioni

Tissue specificityi

Isoform 1 and isoform 3 are expressed in brain, heart, spleen, central nervous system and neuroblastoma cells. Isoform 2 is expressed in skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000067191.
CleanExiHS_CACNB1.
ExpressionAtlasiQ02641. baseline and differential.
GenevisibleiQ02641. HS.

Organism-specific databases

HPAiCAB009779.
HPA023343.

Interactioni

Subunit structurei

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with JSRP1. Interacts with RYR1. Interacts with CBARP (By similarity).By similarity

Protein-protein interaction databases

BioGridi107236. 9 interactors.
IntActiQ02641. 2 interactors.
MINTiMINT-2857287.
STRINGi9606.ENSP00000377840.

Structurei

3D structure databases

ProteinModelPortaliQ02641.
SMRiQ02641.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini100 – 161SH3PROSITE-ProRule annotationAdd BLAST62

Sequence similaritiesi

Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3812. Eukaryota.
ENOG410XRDI. LUCA.
GeneTreeiENSGT00390000002740.
HOVERGENiHBG050765.
InParanoidiQ02641.
KOiK04862.
OMAiSFWGGLE.
OrthoDBiEOG091G09C1.
PhylomeDBiQ02641.
TreeFamiTF316195.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005443. VDCC_L_b1su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01627. LCACHANNELB1.
SMARTiSM00072. GuKc. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q02641-1) [UniParc]FASTAAdd to basket
Also known as: Beta-1b2, BetaA, Beta-1B, Beta1-2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQKTSMSRG PYPPSQEIPM EVFDPSPQGK YSKRKGRFKR SDGSTSSDTT
60 70 80 90 100
SNSFVRQGSA ESYTSRPSDS DVSLEEDREA LRKEAERQAL AQLEKAKTKP
110 120 130 140 150
VAFAVRTNVG YNPSPGDEVP VQGVAITFEP KDFLHIKEKY NNDWWIGRLV
160 170 180 190 200
KEGCEVGFIP SPVKLDSLRL LQEQKLRQNR LGSSKSGDNS SSSLGDVVTG
210 220 230 240 250
TRRPTPPASA KQKQKSTEHV PPYDVVPSMR PIILVGPSLK GYEVTDMMQK
260 270 280 290 300
ALFDFLKHRF DGRISITRVT ADISLAKRSV LNNPSKHIII ERSNTRSSLA
310 320 330 340 350
EVQSEIERIF ELARTLQLVA LDADTINHPA QLSKTSLAPI IVYIKITSPK
360 370 380 390 400
VLQRLIKSRG KSQSKHLNVQ IAASEKLAQC PPEMFDIILD ENQLEDACEH
410 420 430 440 450
LAEYLEAYWK ATHPPSSTPP NPLLNRTMAT AALAASPAPV SNLQGPYLAS
460 470 480 490 500
GDQPLERATG EHASMHEYPG ELGQPPGLYP SSHPPGRAGT LRALSRQDTF
510 520 530 540 550
DADTPGSRNS AYTELGDSCV DMETDPSEGP GLGDPAGGGT PPARQGSWED
560 570 580 590
EEEDYEEELT DNRNRGRNKA RYCAEGGGPV LGRNKNELEG WGRGVYIR
Length:598
Mass (Da):65,714
Last modified:May 2, 2002 - v3
Checksum:i44FE4E3BA6F016FD
GO
Isoform 2 (identifier: Q02641-2) [UniParc]FASTAAdd to basket
Also known as: Beta-1M, BetaC, Beta-1a

The sequence of this isoform differs from the canonical sequence as follows:
     210-216: AKQKQKS → GNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPPPHGKRIPFFKK
     445-478: GPYLASGDQPLERATGEHASMHEYPGELGQPPGL → VQVLTSLRRNLGFWGGLESSQRGSVVPQEQEHAM
     479-598: Missing.

Show »
Length:523
Mass (Da):57,864
Checksum:i9F8B7C748A65087C
GO
Isoform 3 (identifier: Q02641-3) [UniParc]FASTAAdd to basket
Also known as: Beta-1b1, BetaB, Beta-1c, Beta1-3

The sequence of this isoform differs from the canonical sequence as follows:
     445-478: GPYLASGDQPLERATGEHASMHEYPGELGQPPGL → VQVLTSLRRNLGFWGGLESSQRGSVVPQEQEHAM
     479-598: Missing.

Show »
Length:478
Mass (Da):53,006
Checksum:i1D0A53AE67443655
GO

Sequence cautioni

The sequence CAA79825 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti5 – 6TS → SG in AAA36167 (PubMed:7916667).Curated2
Sequence conflicti21E → G in AAA51894 (PubMed:1309651).Curated1
Sequence conflicti28Missing in AAA36168 (PubMed:7916667).Curated1
Sequence conflicti28Missing in AAA36169 (PubMed:7916667).Curated1
Sequence conflicti29G → R in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti29G → R in AAA36168 (PubMed:7916667).Curated1
Sequence conflicti29G → R in AAA36169 (PubMed:7916667).Curated1
Sequence conflicti135H → D in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti175 – 176KL → TV in AAA36167 (PubMed:7916667).Curated2
Sequence conflicti182G → S in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti217T → S in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti264I → T in AAH37311 (PubMed:15489334).Curated1
Sequence conflicti293 – 296SNTR → LQHT in AAA36167 (PubMed:7916667).Curated4
Sequence conflicti344I → L in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti381P → H in AAH37311 (PubMed:15489334).Curated1
Sequence conflicti428M → I in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti434 – 435AA → RR in AAA35631 (PubMed:1385409).Curated2
Sequence conflicti434 – 435AA → RR in AAA35632 (PubMed:1385409).Curated2
Sequence conflicti434 – 435AA → RR in AAA35633 (PubMed:1385409).Curated2
Sequence conflicti434 – 435AA → RR in AAB58779 (PubMed:10624822).Curated2
Sequence conflicti434 – 435AA → RR in AAB58780 (PubMed:10624822).Curated2
Sequence conflicti434 – 435AA → RR in AAB58781 (PubMed:10624822).Curated2
Sequence conflicti456E → D in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti465M → V in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti482S → N in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti492R → W in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti515L → P in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti532L → P in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti539 – 541GTP → A in AAA35633 (PubMed:1385409).Curated3
Sequence conflicti539 – 541GTP → A in AAB58781 (PubMed:10624822).Curated3
Sequence conflicti550Missing in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti559L → M in AAA36167 (PubMed:7916667).Curated1
Sequence conflicti573 – 574CA → WP in AAA35633 (PubMed:1385409).Curated2
Sequence conflicti573 – 574CA → WP in AAB58781 (PubMed:10624822).Curated2
Sequence conflicti593R → Q in AAA36167 (PubMed:7916667).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_036349339P → L in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000623210 – 216AKQKQKS → GNEMTNLAFELDPLELEEEE AELGEQSGSAKTSVSSVTTP PPHGKRIPFFKK in isoform 2. 2 Publications7
Alternative sequenceiVSP_000624445 – 478GPYLA…QPPGL → VQVLTSLRRNLGFWGGLESS QRGSVVPQEQEHAM in isoform 2 and isoform 3. 4 PublicationsAdd BLAST34
Alternative sequenceiVSP_000625479 – 598Missing in isoform 2 and isoform 3. 4 PublicationsAdd BLAST120

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M92303 mRNA. Translation: AAA35633.1.
M92301 mRNA. Translation: AAA35631.1.
M92302 mRNA. Translation: AAA35632.1.
M76560 mRNA. Translation: AAA51894.1.
L06110 mRNA. Translation: AAA36167.1.
L06111 mRNA. Translation: AAA36168.1.
L06112 mRNA. Translation: AAA36169.1.
AB054985 mRNA. Translation: BAB21444.1.
U86960
, U86952, U86953, U86954, U86955, U86956, U86957, U86958, U86959 Genomic DNA. Translation: AAB58779.1.
U86960
, U86952, U86953, U86954, U86955, U86956, U86957, U86958, U86959 Genomic DNA. Translation: AAB58780.1.
U86961
, U86952, U86953, U86954, U86955, U86956, U86957, U86958, U86959, U86960 Genomic DNA. Translation: AAB58781.1. Sequence problems.
AK289729 mRNA. Translation: BAF82418.1.
CH471152 Genomic DNA. Translation: EAW60562.1.
BC037311 mRNA. Translation: AAH37311.2.
Z21725 Genomic DNA. Translation: CAA79824.1.
Z21726 Genomic DNA. Translation: CAA79825.1. Different initiation.
CCDSiCCDS11334.1. [Q02641-2]
CCDS42311.1. [Q02641-1]
CCDS45665.1. [Q02641-3]
PIRiA44461.
B44461.
C44461.
I38002.
I52859.
I65766.
I65767.
JH0566.
RefSeqiNP_000714.3. NM_000723.4. [Q02641-1]
NP_954855.1. NM_199247.2. [Q02641-2]
NP_954856.1. NM_199248.2. [Q02641-3]
UniGeneiHs.635.

Genome annotation databases

EnsembliENST00000344140; ENSP00000345461; ENSG00000067191. [Q02641-2]
ENST00000394303; ENSP00000377840; ENSG00000067191. [Q02641-1]
ENST00000394310; ENSP00000377847; ENSG00000067191. [Q02641-3]
GeneIDi782.
KEGGihsa:782.
UCSCiuc002hrm.2. human. [Q02641-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M92303 mRNA. Translation: AAA35633.1.
M92301 mRNA. Translation: AAA35631.1.
M92302 mRNA. Translation: AAA35632.1.
M76560 mRNA. Translation: AAA51894.1.
L06110 mRNA. Translation: AAA36167.1.
L06111 mRNA. Translation: AAA36168.1.
L06112 mRNA. Translation: AAA36169.1.
AB054985 mRNA. Translation: BAB21444.1.
U86960
, U86952, U86953, U86954, U86955, U86956, U86957, U86958, U86959 Genomic DNA. Translation: AAB58779.1.
U86960
, U86952, U86953, U86954, U86955, U86956, U86957, U86958, U86959 Genomic DNA. Translation: AAB58780.1.
U86961
, U86952, U86953, U86954, U86955, U86956, U86957, U86958, U86959, U86960 Genomic DNA. Translation: AAB58781.1. Sequence problems.
AK289729 mRNA. Translation: BAF82418.1.
CH471152 Genomic DNA. Translation: EAW60562.1.
BC037311 mRNA. Translation: AAH37311.2.
Z21725 Genomic DNA. Translation: CAA79824.1.
Z21726 Genomic DNA. Translation: CAA79825.1. Different initiation.
CCDSiCCDS11334.1. [Q02641-2]
CCDS42311.1. [Q02641-1]
CCDS45665.1. [Q02641-3]
PIRiA44461.
B44461.
C44461.
I38002.
I52859.
I65766.
I65767.
JH0566.
RefSeqiNP_000714.3. NM_000723.4. [Q02641-1]
NP_954855.1. NM_199247.2. [Q02641-2]
NP_954856.1. NM_199248.2. [Q02641-3]
UniGeneiHs.635.

3D structure databases

ProteinModelPortaliQ02641.
SMRiQ02641.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107236. 9 interactors.
IntActiQ02641. 2 interactors.
MINTiMINT-2857287.
STRINGi9606.ENSP00000377840.

Chemistry databases

ChEMBLiCHEMBL2363032.
DrugBankiDB04855. Dronedarone.
DB00898. Ethanol.
DB00308. Ibutilide.
DB00653. Magnesium Sulfate.
DB00393. Nimodipine.
DB00421. Spironolactone.
DB00661. Verapamil.

PTM databases

iPTMnetiQ02641.
PhosphoSitePlusiQ02641.

Polymorphism and mutation databases

BioMutaiCACNB1.
DMDMi20455481.

Proteomic databases

MaxQBiQ02641.
PaxDbiQ02641.
PeptideAtlasiQ02641.
PRIDEiQ02641.

Protocols and materials databases

DNASUi782.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000344140; ENSP00000345461; ENSG00000067191. [Q02641-2]
ENST00000394303; ENSP00000377840; ENSG00000067191. [Q02641-1]
ENST00000394310; ENSP00000377847; ENSG00000067191. [Q02641-3]
GeneIDi782.
KEGGihsa:782.
UCSCiuc002hrm.2. human. [Q02641-1]

Organism-specific databases

CTDi782.
DisGeNETi782.
GeneCardsiCACNB1.
HGNCiHGNC:1401. CACNB1.
HPAiCAB009779.
HPA023343.
MIMi114207. gene.
neXtProtiNX_Q02641.
OpenTargetsiENSG00000067191.
PharmGKBiPA87.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3812. Eukaryota.
ENOG410XRDI. LUCA.
GeneTreeiENSGT00390000002740.
HOVERGENiHBG050765.
InParanoidiQ02641.
KOiK04862.
OMAiSFWGGLE.
OrthoDBiEOG091G09C1.
PhylomeDBiQ02641.
TreeFamiTF316195.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000067191-MONOMER.
ReactomeiR-HSA-112308. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.
R-HSA-419037. NCAM1 interactions.
R-HSA-5576892. Phase 0 - rapid depolarisation.
R-HSA-5576893. Phase 2 - plateau phase.
R-HSA-5576894. Phase 1 - inactivation of fast Na+ channels.

Miscellaneous databases

GeneWikiiCACNB1.
GenomeRNAii782.
PROiQ02641.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000067191.
CleanExiHS_CACNB1.
ExpressionAtlasiQ02641. baseline and differential.
GenevisibleiQ02641. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005443. VDCC_L_b1su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01627. LCACHANNELB1.
SMARTiSM00072. GuKc. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCACB1_HUMAN
AccessioniPrimary (citable) accession number: Q02641
Secondary accession number(s): A8K114
, O15331, Q02639, Q02640, Q8N3X9, Q9C085, Q9UD79
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: May 2, 2002
Last modified: November 2, 2016
This is version 169 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.