Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Paired box protein Pax-5

Gene

PAX5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play an important role in B-cell differentiation as well as neural development and spermatogenesis. Involved in the regulation of the CD19 gene, a B-lymphoid-specific target gene.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Neurogenesis, Spermatogenesis, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:G66-31169-MONOMER.
SignaLinkiQ02548.
SIGNORiQ02548.

Names & Taxonomyi

Protein namesi
Recommended name:
Paired box protein Pax-5
Alternative name(s):
B-cell-specific transcription factor
Short name:
BSAP
Gene namesi
Name:PAX5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:8619. PAX5.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving PAX5 is a cause of acute lymphoblastic leukemia. Translocation t(9;18)(p13;q11.2) with ZNF521. Translocation t(9;3)(p13;p14.1) with FOXP1. Translocation t(9;12)(p13;p13) with ETV6.

Leukemia, acute lymphoblastic, 3 (ALL3)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA subtype of acute leukemia, a cancer of the white blood cells. Acute lymphoblastic anemia is a malignant disease of bone marrow and the most common malignancy diagnosed in children. The malignant cells are lymphoid precursor cells (lymphoblasts) that are arrested in an early stage of development. The lymphoblasts replace the normal marrow elements, resulting in a marked decrease in the production of normal blood cells. Consequently, anemia, thrombocytopenia, and neutropenia occur to varying degrees. The lymphoblasts also proliferate in organs other than the marrow, particularly the liver, spleen, and lymphnodes.
See also OMIM:613065
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_070682183G → S in ALL3; confers susceptibility to ALL3; reduced transcription factor activity. 1 PublicationCorresponds to variant rs398123063dbSNPEnsembl.1

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei158 – 159Breakpoint for translocation to form PAX5-ETV62
Sitei260 – 261Breakpoint for translocation to form PAX5-FOXP12
Sitei303 – 304Breakpoint for translocation to form PAX5-ZNF5212

Keywords - Diseasei

Disease mutation, Proto-oncogene

Organism-specific databases

DisGeNETi5079.
MalaCardsiPAX5.
MIMi613065. phenotype.
OpenTargetsiENSG00000196092.
Orphaneti99860. Precursor B-cell acute lymphoblastic leukemia.
PharmGKBiPA32959.

Polymorphism and mutation databases

BioMutaiPAX5.
DMDMi417449.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000501831 – 391Paired box protein Pax-5Add BLAST391

Post-translational modificationi

O-glycosylated.Curated

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ02548.
PeptideAtlasiQ02548.
PRIDEiQ02548.

PTM databases

iPTMnetiQ02548.
PhosphoSitePlusiQ02548.

Expressioni

Developmental stagei

Expressed at early B-cell differentiation, in the developing CNS and in adult testis.

Gene expression databases

BgeeiENSG00000196092.
CleanExiHS_PAX5.
ExpressionAtlasiQ02548. baseline and differential.
GenevisibleiQ02548. HS.

Organism-specific databases

HPAiCAB026269.
CAB026869.
HPA056394.

Interactioni

Subunit structurei

Interacts with DAXX (By similarity). Binds DNA as a monomer. Binds TLE4. Interacts with ETS1, altering its DNA-binding properties.By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
KMT2AQ031642EBI-296331,EBI-2610266

Protein-protein interaction databases

BioGridi111113. 9 interactors.
IntActiQ02548. 31 interactors.
STRINGi9606.ENSP00000350844.

Structurei

Secondary structure

1391
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi35 – 46Combined sources12
Helixi51 – 58Combined sources8
Helixi62 – 75Combined sources14
Beta strandi89 – 91Combined sources3
Helixi93 – 105Combined sources13
Helixi111 – 120Combined sources10
Turni126 – 128Combined sources3
Helixi132 – 140Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1K78X-ray2.25A/E/I1-149[»]
1MDMX-ray2.80A1-149[»]
ProteinModelPortaliQ02548.
SMRiQ02548.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ02548.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini16 – 142PairedPROSITE-ProRule annotationAdd BLAST127

Sequence similaritiesi

Contains 1 paired domain.PROSITE-ProRule annotation

Keywords - Domaini

Paired box

Phylogenomic databases

eggNOGiKOG3862. Eukaryota.
ENOG410ZT0S. LUCA.
GeneTreeiENSGT00680000099553.
HOGENOMiHOG000230939.
HOVERGENiHBG009115.
InParanoidiQ02548.
KOiK09383.
OMAiYPTPRTG.
OrthoDBiEOG091G0S4E.
PhylomeDBiQ02548.
TreeFamiTF315397.

Family and domain databases

CDDicd00131. PAX. 1 hit.
Gene3Di1.10.10.10. 2 hits.
InterProiIPR009057. Homeodomain-like.
IPR001523. Paired_dom.
IPR022130. Pax2_C.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00292. PAX. 1 hit.
PF12403. Pax2_C. 1 hit.
[Graphical view]
PRINTSiPR00027. PAIREDBOX.
SMARTiSM00351. PAX. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS00034. PAIRED_1. 1 hit.
PS51057. PAIRED_2. 1 hit.
[Graphical view]

Sequences (11)i

Sequence statusi: Complete.

This entry describes 11 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q02548-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLEKNYPTP RTSRTGHGGV NQLGGVFVNG RPLPDVVRQR IVELAHQGVR
60 70 80 90 100
PCDISRQLRV SHGCVSKILG RYYETGSIKP GVIGGSKPKV ATPKVVEKIA
110 120 130 140 150
EYKRQNPTMF AWEIRDRLLA ERVCDNDTVP SVSSINRIIR TKVQQPPNQP
160 170 180 190 200
VPASSHSIVS TGSVTQVSSV STDSAGSSYS ISGILGITSP SADTNKRKRD
210 220 230 240 250
EGIQESPVPN GHSLPGRDFL RKQMRGDLFT QQQLEVLDRV FERQHYSDIF
260 270 280 290 300
TTTEPIKPEQ TTEYSAMASL AGGLDDMKAN LASPTPADIG SSVPGPQSYP
310 320 330 340 350
IVTGRDLAST TLPGYPPHVP PAGQGSYSAP TLTGMVPGSE FSGSPYSHPQ
360 370 380 390
YSSYNDSWRF PNPGLLGSPY YYSAAARGAA PPAAATAYDR H
Length:391
Mass (Da):42,149
Last modified:October 1, 1993 - v1
Checksum:iDB37E6EACD9F993A
GO
Isoform 2 (identifier: Q02548-2) [UniParc]FASTAAdd to basket
Also known as: delta9

The sequence of this isoform differs from the canonical sequence as follows:
     338-366: Missing.

Show »
Length:362
Mass (Da):38,890
Checksum:i6570B3D758CC4DFC
GO
Isoform 3 (identifier: Q02548-3) [UniParc]FASTAAdd to basket
Also known as: delta78

The sequence of this isoform differs from the canonical sequence as follows:
     261-282: TTEYSAMASLAGGLDDMKANLA → GVSFPGVPTATLSIPRTTTPGG
     286-315: PADIGSSVPGPQSYPIVTGRDLASTTLPGY → RGCLAPPIIIALPPEE
     319-391: VPPAGQGSYS...PAAATAYDRH → LQPPLPMTVTDPWSQAGTKH

Show »
Length:324
Mass (Da):35,281
Checksum:iF6A0BFF245B8B965
GO
Isoform 4 (identifier: Q02548-4) [UniParc]FASTAAdd to basket
Also known as: delta789

The sequence of this isoform differs from the canonical sequence as follows:
     261-315: TTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGY → APPIIIALPPEE
     319-391: VPPAGQGSYS...PAAATAYDRH → LQPPLPMTVTDPWSQAGTKH

Show »
Length:295
Mass (Da):32,471
Checksum:iD5EEA5066EE14214
GO
Isoform 5 (identifier: Q02548-5) [UniParc]FASTAAdd to basket
Also known as: delta8

The sequence of this isoform differs from the canonical sequence as follows:
     261-391: TTEYSAMASL...PAAATAYDRH → AVTWRARPSPGTLHTSPPLDRAATQHRR

Show »
Length:288
Mass (Da):31,830
Checksum:i38E17187FCE243A4
GO
Isoform 6 (identifier: Q02548-6) [UniParc]FASTAAdd to basket
Also known as: delta7

The sequence of this isoform differs from the canonical sequence as follows:
     305-349: RDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHP → SEFSGSPYSHP

Show »
Length:357
Mass (Da):38,773
Checksum:iD9002C0265083C8D
GO
Isoform 7 (identifier: Q02548-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-366: Missing.

Show »
Length:328
Mass (Da):35,514
Checksum:i92D63742F8C95496
GO
Isoform 8 (identifier: Q02548-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-201: Missing.

Show »
Length:348
Mass (Da):37,834
Checksum:i4A0BED6DADED06FC
GO
Isoform 9 (identifier: Q02548-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-201: Missing.
     338-366: Missing.

Show »
Length:319
Mass (Da):34,574
Checksum:i9478E6354E6E9B7B
GO
Isoform 10 (identifier: Q02548-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-136: Missing.
     304-337: Missing.

Show »
Length:291
Mass (Da):31,381
Checksum:i9DA0FDAAE882FD03
GO
Isoform 11 (identifier: Q02548-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     261-307: TTEYSAMASL...SYPIVTGRDL → WCPVLMRQYL...LDRAATQHRR
     308-391: Missing.

Show »
Length:307
Mass (Da):34,132
Checksum:i25F6F696F292DC04
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti99I → F in AAC35286 (PubMed:9742255).Curated1
Sequence conflicti141 – 143TKV → PKL in AAC35286 (PubMed:9742255).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07067224G → R.1 Publication1
Natural variantiVAR_07067326V → G.1 Publication1
Natural variantiVAR_07067434P → Q.1 Publication1
Natural variantiVAR_07067553D → V.1 Publication1
Natural variantiVAR_07067659R → G.1 Publication1
Natural variantiVAR_07067766S → N.1 Publication1
Natural variantiVAR_07067875T → R.1 Publication1
Natural variantiVAR_07067980P → R.1 Publication1
Natural variantiVAR_070680139I → T.1 Publication1
Natural variantiVAR_070681151V → I.1 PublicationCorresponds to variant rs115889954dbSNPEnsembl.1
Natural variantiVAR_070682183G → S in ALL3; confers susceptibility to ALL3; reduced transcription factor activity. 1 PublicationCorresponds to variant rs398123063dbSNPEnsembl.1
Natural variantiVAR_070683183G → V.1 Publication1
Natural variantiVAR_070684213S → L.1 PublicationCorresponds to variant rs137870876dbSNPEnsembl.1
Natural variantiVAR_070685301I → T.1 PublicationCorresponds to variant rs372989600dbSNPEnsembl.1
Natural variantiVAR_034370322A → T.Corresponds to variant rs34810717dbSNPEnsembl.1
Natural variantiVAR_070686338G → V.1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04782771 – 136Missing in isoform 10. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_047828159 – 201Missing in isoform 8 and isoform 9. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_044115261 – 391TTEYS…AYDRH → AVTWRARPSPGTLHTSPPLD RAATQHRR in isoform 5. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_044116261 – 315TTEYS…TLPGY → APPIIIALPPEE in isoform 4. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_047829261 – 307TTEYS…TGRDL → WCPVLMRQYLVQPQAVLFQA VTWRARPSPGTLHTSPPLDR AATQHRR in isoform 11. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_044117261 – 282TTEYS…KANLA → GVSFPGVPTATLSIPRTTTP GG in isoform 3. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_044118286 – 315PADIG…TLPGY → RGCLAPPIIIALPPEE in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_047830304 – 366Missing in isoform 7. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_047831304 – 337Missing in isoform 10. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_044119305 – 349RDLAS…PYSHP → SEFSGSPYSHP in isoform 6. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_047832308 – 391Missing in isoform 11. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_044120319 – 391VPPAG…AYDRH → LQPPLPMTVTDPWSQAGTKH in isoform 3 and isoform 4. 1 PublicationAdd BLAST73
Alternative sequenceiVSP_044121338 – 366Missing in isoform 2 and isoform 9. 2 PublicationsAdd BLAST29

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M96944 mRNA. Translation: AAA58397.1.
AY463952 mRNA. Translation: AAR27590.1.
AY463953 mRNA. Translation: AAR27591.1.
AY463954 mRNA. Translation: AAR27592.1.
AY463955 mRNA. Translation: AAR27593.1.
AY463956 mRNA. Translation: AAR27594.1.
AY463957 mRNA. Translation: AAR27595.1.
FJ626421 mRNA. Translation: ACM91604.1.
FJ626422 mRNA. Translation: ACM91605.1.
FJ626423 mRNA. Translation: ACM91606.1.
FJ626424 mRNA. Translation: ACM91607.1.
FJ626425 mRNA. Translation: ACM91608.1.
EF064717 Genomic DNA. Translation: ABK41900.1.
AL161781, AL450267 Genomic DNA. Translation: CAH72137.1.
AL450267, AL161781 Genomic DNA. Translation: CAH72740.1.
CH471071 Genomic DNA. Translation: EAW58294.1.
CH471071 Genomic DNA. Translation: EAW58295.1.
CH471071 Genomic DNA. Translation: EAW58296.1.
CH471071 Genomic DNA. Translation: EAW58297.1.
CH471071 Genomic DNA. Translation: EAW58298.1.
CH471071 Genomic DNA. Translation: EAW58299.1.
DQ841178 mRNA. Translation: ABI30005.1. Different termination.
DQ845345 mRNA. Translation: ABI33104.1. Different termination.
DQ845346 mRNA. Translation: ABI33105.1. Different termination.
AF080573 mRNA. Translation: AAC35286.1.
CCDSiCCDS65041.1. [Q02548-10]
CCDS65042.1. [Q02548-9]
CCDS65043.1. [Q02548-8]
CCDS65044.1. [Q02548-4]
CCDS65045.1. [Q02548-3]
CCDS65046.1. [Q02548-7]
CCDS65047.1. [Q02548-6]
CCDS65048.1. [Q02548-2]
CCDS6607.1. [Q02548-1]
PIRiA44063.
RefSeqiNP_001267476.1. NM_001280547.1. [Q02548-6]
NP_001267477.1. NM_001280548.1. [Q02548-2]
NP_001267478.1. NM_001280549.1.
NP_001267479.1. NM_001280550.1.
NP_001267481.1. NM_001280552.1. [Q02548-7]
NP_001267482.1. NM_001280553.1. [Q02548-9]
NP_001267483.1. NM_001280554.1. [Q02548-8]
NP_001267484.1. NM_001280555.1. [Q02548-10]
NP_001267485.1. NM_001280556.1.
NP_057953.1. NM_016734.2. [Q02548-1]
UniGeneiHs.654464.

Genome annotation databases

EnsembliENST00000358127; ENSP00000350844; ENSG00000196092. [Q02548-1]
ENST00000377840; ENSP00000367071; ENSG00000196092. [Q02548-5]
ENST00000377847; ENSP00000367078; ENSG00000196092. [Q02548-7]
ENST00000377852; ENSP00000367083; ENSG00000196092. [Q02548-6]
ENST00000377853; ENSP00000367084; ENSG00000196092. [Q02548-2]
ENST00000414447; ENSP00000412188; ENSG00000196092. [Q02548-8]
ENST00000446742; ENSP00000404687; ENSG00000196092. [Q02548-10]
ENST00000520281; ENSP00000430773; ENSG00000196092. [Q02548-9]
ENST00000523493; ENSP00000431038; ENSG00000196092. [Q02548-11]
GeneIDi5079.
KEGGihsa:5079.
UCSCiuc003zzo.3. human. [Q02548-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M96944 mRNA. Translation: AAA58397.1.
AY463952 mRNA. Translation: AAR27590.1.
AY463953 mRNA. Translation: AAR27591.1.
AY463954 mRNA. Translation: AAR27592.1.
AY463955 mRNA. Translation: AAR27593.1.
AY463956 mRNA. Translation: AAR27594.1.
AY463957 mRNA. Translation: AAR27595.1.
FJ626421 mRNA. Translation: ACM91604.1.
FJ626422 mRNA. Translation: ACM91605.1.
FJ626423 mRNA. Translation: ACM91606.1.
FJ626424 mRNA. Translation: ACM91607.1.
FJ626425 mRNA. Translation: ACM91608.1.
EF064717 Genomic DNA. Translation: ABK41900.1.
AL161781, AL450267 Genomic DNA. Translation: CAH72137.1.
AL450267, AL161781 Genomic DNA. Translation: CAH72740.1.
CH471071 Genomic DNA. Translation: EAW58294.1.
CH471071 Genomic DNA. Translation: EAW58295.1.
CH471071 Genomic DNA. Translation: EAW58296.1.
CH471071 Genomic DNA. Translation: EAW58297.1.
CH471071 Genomic DNA. Translation: EAW58298.1.
CH471071 Genomic DNA. Translation: EAW58299.1.
DQ841178 mRNA. Translation: ABI30005.1. Different termination.
DQ845345 mRNA. Translation: ABI33104.1. Different termination.
DQ845346 mRNA. Translation: ABI33105.1. Different termination.
AF080573 mRNA. Translation: AAC35286.1.
CCDSiCCDS65041.1. [Q02548-10]
CCDS65042.1. [Q02548-9]
CCDS65043.1. [Q02548-8]
CCDS65044.1. [Q02548-4]
CCDS65045.1. [Q02548-3]
CCDS65046.1. [Q02548-7]
CCDS65047.1. [Q02548-6]
CCDS65048.1. [Q02548-2]
CCDS6607.1. [Q02548-1]
PIRiA44063.
RefSeqiNP_001267476.1. NM_001280547.1. [Q02548-6]
NP_001267477.1. NM_001280548.1. [Q02548-2]
NP_001267478.1. NM_001280549.1.
NP_001267479.1. NM_001280550.1.
NP_001267481.1. NM_001280552.1. [Q02548-7]
NP_001267482.1. NM_001280553.1. [Q02548-9]
NP_001267483.1. NM_001280554.1. [Q02548-8]
NP_001267484.1. NM_001280555.1. [Q02548-10]
NP_001267485.1. NM_001280556.1.
NP_057953.1. NM_016734.2. [Q02548-1]
UniGeneiHs.654464.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1K78X-ray2.25A/E/I1-149[»]
1MDMX-ray2.80A1-149[»]
ProteinModelPortaliQ02548.
SMRiQ02548.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111113. 9 interactors.
IntActiQ02548. 31 interactors.
STRINGi9606.ENSP00000350844.

PTM databases

iPTMnetiQ02548.
PhosphoSitePlusiQ02548.

Polymorphism and mutation databases

BioMutaiPAX5.
DMDMi417449.

Proteomic databases

PaxDbiQ02548.
PeptideAtlasiQ02548.
PRIDEiQ02548.

Protocols and materials databases

DNASUi5079.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358127; ENSP00000350844; ENSG00000196092. [Q02548-1]
ENST00000377840; ENSP00000367071; ENSG00000196092. [Q02548-5]
ENST00000377847; ENSP00000367078; ENSG00000196092. [Q02548-7]
ENST00000377852; ENSP00000367083; ENSG00000196092. [Q02548-6]
ENST00000377853; ENSP00000367084; ENSG00000196092. [Q02548-2]
ENST00000414447; ENSP00000412188; ENSG00000196092. [Q02548-8]
ENST00000446742; ENSP00000404687; ENSG00000196092. [Q02548-10]
ENST00000520281; ENSP00000430773; ENSG00000196092. [Q02548-9]
ENST00000523493; ENSP00000431038; ENSG00000196092. [Q02548-11]
GeneIDi5079.
KEGGihsa:5079.
UCSCiuc003zzo.3. human. [Q02548-1]

Organism-specific databases

CTDi5079.
DisGeNETi5079.
GeneCardsiPAX5.
HGNCiHGNC:8619. PAX5.
HPAiCAB026269.
CAB026869.
HPA056394.
MalaCardsiPAX5.
MIMi167414. gene.
613065. phenotype.
neXtProtiNX_Q02548.
OpenTargetsiENSG00000196092.
Orphaneti99860. Precursor B-cell acute lymphoblastic leukemia.
PharmGKBiPA32959.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3862. Eukaryota.
ENOG410ZT0S. LUCA.
GeneTreeiENSGT00680000099553.
HOGENOMiHOG000230939.
HOVERGENiHBG009115.
InParanoidiQ02548.
KOiK09383.
OMAiYPTPRTG.
OrthoDBiEOG091G0S4E.
PhylomeDBiQ02548.
TreeFamiTF315397.

Enzyme and pathway databases

BioCyciZFISH:G66-31169-MONOMER.
SignaLinkiQ02548.
SIGNORiQ02548.

Miscellaneous databases

ChiTaRSiPAX5. human.
EvolutionaryTraceiQ02548.
GeneWikiiPAX5.
GenomeRNAii5079.
PROiQ02548.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000196092.
CleanExiHS_PAX5.
ExpressionAtlasiQ02548. baseline and differential.
GenevisibleiQ02548. HS.

Family and domain databases

CDDicd00131. PAX. 1 hit.
Gene3Di1.10.10.10. 2 hits.
InterProiIPR009057. Homeodomain-like.
IPR001523. Paired_dom.
IPR022130. Pax2_C.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00292. PAX. 1 hit.
PF12403. Pax2_C. 1 hit.
[Graphical view]
PRINTSiPR00027. PAIREDBOX.
SMARTiSM00351. PAX. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS00034. PAIRED_1. 1 hit.
PS51057. PAIRED_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPAX5_HUMAN
AccessioniPrimary (citable) accession number: Q02548
Secondary accession number(s): A3QVP6
, A3QVP7, A3QVP8, C0KTF6, C0KTF7, C0KTF8, C0KTF9, C0KTG0, O75933, Q5SFM2, Q6S728, Q6S729, Q6S730, Q6S731, Q6S732
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: November 30, 2016
This is version 158 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.