Q02447 (SP3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transcription factor Sp3 Alternative name(s): SPR-2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 781 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcriptional factor that can act as an activator or repressor depending on isoform and/or post-translational modifications. Binds to GT and GC boxes promoter elements. Competes with SP1 for the GC-box promoters. Weak activator of transcription but can activate a number of genes involved in different processes such as cell-cycle regulation, hormone-induction and house-keeping. Ref.10 Ref.11 Ref.12 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 Ref.21 Ref.22 |
| Subunit structure | Interacts with HLTF; the interaction may be required for basal transcriptional activity of HLTF. Interacts with HDAC1; the interaction deacetylates SP3 and regulates its transcriptional activity. Interacts with HDAC2 (preferably the CK2-phosphorylated form); the interaction deacetylates SP3 and regulates its transcriptional activity. Ref.11 Ref.13 Ref.15 Ref.20 |
| Subcellular location | Nucleus. Nucleus › PML body. Note: Localizes to the nuclear periphery and in nuclear dots when sumoylated. Some localization in PML nuclear bodies. Ref.14 Ref.17 Ref.21 |
| Tissue specificity | Ubiquitously expressed. |
| Post-translational modification | Not glycosylated. Ref.16 Acetylated by histone acetyltransferase p300, deacetylated by HDACs. Acetylation/deacetylation states regulate transcriptional activity. Acetylation appears to activate transcription. Alternate sumoylation and acetylation at Lys-551 also control transcriptional activity. Ceramides can also regulate acetylation/deacetylation events through altering the interaction of HDAC with SP3. In vitro, C(18)-ceramides, but not C(16)-ceramides, increase the interaction of HDAC1 with SP3 and enhance the deacetylation of SP3 and the subsequent repression of the TERT promoter. Sumoylated on all isoforms. Sumoylated on 2 sites in longer isoforms with Lys-551 being the major site. Sumoylation at this site promotes nuclear localization to the nuclear periphery, nuclear dots and PML nuclear bodies. Sumoylation on Lys-551 represses the transactivation activity, except for the largest isoform, L-Sp3, which has little effect on transactivation. Alternate sumoylation and acetylation at Lys-551 also control transcriptional activity. Ref.14 Ref.16 Ref.17 Ref.19 Ref.22 |
| Sequence similarities | Belongs to the Sp1 C2H2-type zinc-finger protein family. Contains 3 C2H2-type zinc fingers. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative initiation Alternative splicing Polymorphism |
| Domain | Repeat Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| Molecular function | Activator Repressor |
| PTM | Acetylation Isopeptide bond Phosphoprotein Ubl conjugation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | positive regulation of transcription, DNA-dependent Inferred from direct assay. Source: UniProtKB |
| Cellular component | PML body Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction Ref.11Ref.13. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing and alternative initiation. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q02447-1) Also known as: Large; L-Sp3; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q02447-2) The sequence of this isoform differs from the canonical sequence as follows: 1-12: Missing. | ||||||
| Note: Produced by alternative initiation at Met-13 of isoform 1. No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q02447-3) Also known as: M1-Sp3; The sequence of this isoform differs from the canonical sequence as follows: 1-285: Missing. | ||||||
| Note: Produced by alternative initiation at Met-286 of isoform 1. No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q02447-4) Also known as: M2-Sp3; The sequence of this isoform differs from the canonical sequence as follows: 1-302: Missing. | ||||||
| Note: Produced by alternative initiation at Met-303 of isoform 1. No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q02447-5) The sequence of this isoform differs from the canonical sequence as follows: 1-69: MTAPEKPVKQEEMAALDVDSGGGGGGGGGHGEYLQQQQQHGNGAVAAAAAAQDTQPSPLALLAATCSKI → M | ||||||
| Note: Produced by alternative splicing. An AUA codon is translated into Met and used as a translation initiation site (in vitro). | ||||||
| Isoform 6 (identifier: Q02447-6) The sequence of this isoform differs from the canonical sequence as follows: 1-12: Missing. 53-93: Missing. | ||||||
| Note: Produced by alternative splicing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 781 | 781 | Transcription factor Sp3 | PRO_0000047141 | |||||
Regions | |||||||||
| Zinc finger | 621 – 645 | 25 | C2H2-type 1 | ||||||
| Zinc finger | 651 – 675 | 25 | C2H2-type 2 | ||||||
| Zinc finger | 681 – 703 | 23 | C2H2-type 3 | ||||||
| Region | 138 – 237 | 100 | Transactivation domain (Gln-rich) | ||||||
| Region | 350 – 499 | 150 | Transactivation domain (Gln-rich) | ||||||
| Region | 534 – 620 | 87 | Repressor domain | ||||||
| Compositional bias | 21 – 31 | 11 | Poly-Gly | ||||||
| Compositional bias | 35 – 39 | 5 | Poly-Gln | ||||||
| Compositional bias | 44 – 100 | 57 | Ala-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 73 | 1 | Phosphoserine Ref.23 Ref.24 | ||||||
| Modified residue | 551 | 1 | N6-acetyllysine; alternate Ref.12 Ref.18 | ||||||
| Modified residue | 563 | 1 | Phosphoserine Ref.23 | ||||||
| Modified residue | 566 | 1 | Phosphoserine Ref.23 | ||||||
| Modified residue | 646 | 1 | Phosphoserine Ref.23 | ||||||
| Cross-link | 120 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.14 | |||||||
| Cross-link | 551 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate Ref.14 Ref.17 Ref.19 Ref.22 | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 302 | 302 | Missing in isoform 4. | VSP_026698 | |||||
| Alternative sequence | 1 – 285 | 285 | Missing in isoform 3. | VSP_026699 | |||||
| Alternative sequence | 1 – 69 | 69 | MTAPE…TCSKI → M in isoform 5. | VSP_026700 | |||||
| Alternative sequence | 1 – 12 | 12 | Missing in isoform 2 and isoform 6. | VSP_026701 | |||||
| Alternative sequence | 53 – 93 | 41 | Missing in isoform 6. | VSP_026702 | |||||
| Natural variant | 164 | 1 | T → A. Ref.1 Ref.2 Ref.9 Corresponds to variant rs1047640 [ dbSNP | Ensembl ]. | VAR_016123 | |||||
Experimental info | |||||||||
| Mutagenesis | 120 | 1 | K → R: Some loss of sumoylation. Slight increase in transcriptional activity. Large increase in transcriptional activity; when associated with R-551. Ref.14 | ||||||
| Mutagenesis | 551 – 553 | 3 | KEE → AAA: Increases transcriptional activity. Ref.14 Ref.17 Ref.19 Ref.20 | ||||||
| Mutagenesis | 551 – 553 | 3 | KEE → REA: 200-fold increase in transcriptional activation. Ref.14 Ref.17 Ref.19 Ref.20 | ||||||
| Mutagenesis | 551 – 553 | 3 | KEE → RED: 200-fold increase in transcriptional activation. Ref.14 Ref.17 Ref.19 Ref.20 | ||||||
| Mutagenesis | 551 – 552 | 2 | KE → RA: 200-fold increase in transcriptional activation. Ref.14 Ref.19 Ref.20 | ||||||
| Mutagenesis | 551 – 552 | 2 | KE → RD: 200-fold increase in transcriptional activation. Ref.14 Ref.19 Ref.20 | ||||||
| Mutagenesis | 551 | 1 | K → Q: A decreased interaction with HDAC1 and deacetylation of SP3. Increase of about 4.5% of activity of the TERT promoter. Decreased recruitment of HDAC1 and increased binding of RNA polymerase II with promoter DNA. Ref.14 Ref.19 Ref.20 | ||||||
| Mutagenesis | 551 | 1 | K → R: Great loss of sumoylation, 20-fold increase in transcriptional activity and diffuse nuclear localization. Further small increase in transcriptional activity; when associated with R-120. Increased interaction with HDAC1 and deacetylation of SP3. About 50% decrease in activity of the TERT promoter. Enhances recruitment of HDAC1 and inhibits binding of RNA polymerase II with promoter DNA. Ref.14 Ref.19 Ref.20 | ||||||
| Sequence conflict | 69 | 1 | I → M in AAR30505. Ref.2 | ||||||
| Sequence conflict | 71 | 1 | P → G in AAA36630. Ref.7 | ||||||
| Sequence conflict | 739 | 1 | N → K in AAL58086. Ref.1 | ||||||
| Sequence conflict | 739 | 1 | N → K in AAR30505. Ref.2 | ||||||
| Sequence conflict | 739 | 1 | N → K in AAR30506. Ref.2 | ||||||
| Sequence conflict | 739 | 1 | N → K in CAA48562. Ref.8 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "AUA as a translation initiation site in vitro for the human transcription factor Sp3." Hernandez E.M., Johnson A., Notario V., Chen A., Richert J.R. J. Biochem. Mol. Biol. 35:273-282(2002) [PubMed: 12297010] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), VARIANT ALA-164. |
| [2] | "Human transcription factor Sp3: genomic structure, identification of a processed pseudogene, and transcript analysis." Moran K.M., Crusio R.H., Chan C.H., Grekova M.C., Richert J.R. Gene 341:235-247(2004) [PubMed: 15474306] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 6), ALTERNATIVE INITIATION (ISOFORMS 2; 3 AND 4), VARIANT ALA-164. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Trachea. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lung. |
| [5] | "5' genomic structure of human Sp3." Oleksiak M.F., Crawford D.L. Mol. Biol. Evol. 19:2026-2029(2002) [PubMed: 12411611] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-135. |
| [6] | "Regulation of hTERT-gene transcription by SP3." Meyer-Grahle U. Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 13-112. |
| [7] | Kingsley C., Winoto A. Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 71-781, SEQUENCE REVISION. Tissue: T-cell. |
| [8] | "Cloning of GT box-binding proteins: a novel Sp1 multigene family regulating T-cell receptor gene expression." Kingsley C., Winoto A. Mol. Cell. Biol. 12:4251-4261(1992) [PubMed: 1341900] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 129-781. |
| [9] | "Cloning by recognition site screening of two novel GT box binding proteins: a family of Sp1 related genes." Hagen G., Mueller S., Beato M., Suske G. Nucleic Acids Res. 20:5519-5525(1992) [PubMed: 1454515] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 85-781, VARIANT ALA-164. Tissue: Uterus. |
| [10] | "Sp3 is a transcriptional activator of the human alpha2(I) collagen gene." Ihn H., Trojanowska M. Nucleic Acids Res. 25:3712-3717(1997) [PubMed: 9278495] [Abstract] Cited for: FUNCTION. |
| [11] | "Functional interactions between Sp1 or Sp3 and the helicase-like transcription factor mediate basal expression from the human plasminogen activator inhibitor-1 gene." Ding H., Benotmane A.M., Suske G., Collen D., Belayew A. J. Biol. Chem. 274:19573-19580(1999) [PubMed: 10391891] [Abstract] Cited for: FUNCTION, INTERACTION WITH HLTF. |
| [12] | "Transcription factor Sp3 is regulated by acetylation." Braun H., Koop R., Ertmer A., Nacht S., Suske G. Nucleic Acids Res. 29:4994-5000(2001) [PubMed: 11812829] [Abstract] Cited for: ACETYLATION AT LYS-551, FUNCTION, MUTAGENESIS OF 551-LYS--GLU-557. |
| [13] | "The transcriptional repressor Sp3 is associated with CK2-phosphorylated histone deacetylase 2." Sun J.M., Chen H.Y., Moniwa M., Litchfield D.W., Seto E., Davie J.R. J. Biol. Chem. 277:35783-35786(2002) [PubMed: 12176973] [Abstract] Cited for: INTERACTION WITH HDAC1 AND HDAC2. |
| [14] | "SUMO-1 modification represses Sp3 transcriptional activation and modulates its subnuclear localization." Ross S., Best J.L., Zon L.I., Gill G. Mol. Cell 10:831-842(2002) [PubMed: 12419227] [Abstract] Cited for: SUMOYLATION AT LYS-120 AND LYS-551, SUBCELLULAR LOCATION, FUNCTION, MUTAGENESIS OF LYS-120 AND LYS-551. |
| [15] | "Acetylated SP3 is a transcriptional activator." Ammanamanchi S., Freeman J.W., Brattain M.G. J. Biol. Chem. 278:35775-35780(2003) [PubMed: 12837748] [Abstract] Cited for: INTERACTION WITH HDAC1 AND EP300, ACETYLATION, FUNCTION. |
| [16] | "Complexity of translationally controlled transcription factor Sp3 isoform expression." Sapetschnig A., Koch F., Rischitor G., Mennenga T., Suske G. J. Biol. Chem. 279:42095-42105(2004) [PubMed: 15247228] [Abstract] Cited for: SUMOYLATION, ALTERNATIVE PRODUCTS, LACK OF GLYCOSYLATION, FUNCTION. |
| [17] | "Sumoylation of internally initiated Sp3 isoforms regulates transcriptional repression via a Trichostatin A-insensitive mechanism." Spengler M.L., Kennett S.B., Moorefield K.S., Simmons S.O., Brattain M.G., Horowitz J.M. Cell. Signal. 17:153-166(2005) [PubMed: 15494207] [Abstract] Cited for: SUMOYLATION AT LYS-551, FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF 551-LYS--GLU-553. |
| [18] | "Sp3 is involved in the regulation of SOCS3 gene expression." Ehlting C., Haussinger D., Bode J.G. Biochem. J. 387:737-745(2005) [PubMed: 15554904] [Abstract] Cited for: ACETYLATION AT LYS-551, FUNCTION. |
| [19] | "The modification of Sp3 isoforms by SUMOylation has differential effects on the SRC1A promoter." Ellis D.J., Dehm S.M., Bonham K. Gene 379:68-78(2006) [PubMed: 16781829] [Abstract] Cited for: SUMOYLATION AT LYS-551, FUNCTION OF ISOFORMS, MUTAGENESIS OF LYS-551. |
| [20] | "Mechanisms of ceramide-mediated repression of the human telomerase reverse transcriptase promoter via deacetylation of Sp3 by histone deacetylase 1." Wooten-Blanks L.G., Song P., Senkal C.E., Ogretmen B. FASEB J. 21:3386-3397(2007) [PubMed: 17548428] [Abstract] Cited for: FUNCTION, DEACETYLATION, INTERACTION WITH HDAC1, MUTAGENESIS OF LYS-551. |
| [21] | "Nuclear organization and chromatin dynamics--Sp1, Sp3 and histone deacetylases." Davie J.R., He S., Li L., Sekhavat A., Espino P., Drobic B., Dunn K.L., Sun J.M., Chen H.Y., Yu J., Pritchard S., Wang X. Adv. Enzyme Regul. 48:189-208(2008) [PubMed: 18187045] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [22] | "SUMO-modified Sp3 represses transcription by provoking local heterochromatic gene silencing." Stielow B., Sapetschnig A., Wink C., Kraeger I., Suske G. EMBO Rep. 9:899-906(2008) [PubMed: 18617891] [Abstract] Cited for: SUMOYLATION AT LYS-551, FUNCTION OF ISOFORMS. |
| [23] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-73; SER-563; SER-566 AND SER-646, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [24] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-73, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY070137 mRNA. Translation: AAL58086.1. AY441957 mRNA. Translation: AAR30505.1. AY441958 mRNA. Translation: AAR30506.1. AK304199 mRNA. Translation: BAG65079.1. BC126414 mRNA. Translation: AAI26415.1. AF494280 Genomic DNA. Translation: AAM12875.1. AJ310752 mRNA. Translation: CAC34575.1. M97191 mRNA. Translation: AAA36630.2. X68560 mRNA. Translation: CAA48562.1. |
| IPI | IPI00025807. IPI00555936. IPI00852622. IPI00852778. IPI00853503. IPI01014738. |
| PIR | B44489. |
| RefSeq | NP_001017371.3. NM_001017371.4. NP_001166183.1. NM_001172712.1. NP_003102.1. NM_003111.4. |
| UniGene | Hs.531587. |
3D structure databases | |
| ProteinModelPortal | Q02447. |
| SMR | Q02447. Positions 611-707. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q02447. 5 interactions. |
| MINT | MINT-189716. |
| STRING | Q02447. |
PTM databases | |
| PhosphoSite | Q02447. |
Polymorphism databases | |
| DMDM | 30923147. |
Proteomic databases | |
| PRIDE | Q02447. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000310015; ENSP00000310301; ENSG00000172845. |
| GeneID | 6670. |
| KEGG | hsa:6670. |
| UCSC | uc002uie.1. human. uc002uig.1. human. |
Organism-specific databases | |
| CTD | 6670. |
| GeneCards | GC02M174771. |
| H-InvDB | HIX0023980. |
| HGNC | HGNC:11208. SP3. |
| HPA | CAB004580. |
| MIM | 601804. gene. |
| neXtProt | NX_Q02447. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG18109. |
| HOVERGEN | HBG008933. |
| InParanoid | Q02447. |
| OMA | VTSSGQY. |
| OrthoDB | EOG405S0Z. |
| PhylomeDB | Q02447. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | hnf3bpathway. FOXA2 and FOXA3 transcription factor networks. hif1_tfpathway. HIF-1-alpha transcription factor network. telomerasepathway. Regulation of Telomerase. |
Gene expression databases | |
| ArrayExpress | Q02447. |
| Bgee | Q02447. |
| CleanEx | HS_SP3. |
| Genevestigator | Q02447. |
| GermOnline | ENSG00000172845. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] |
| Gene3D | G3DSA:3.30.160.60. Znf_C2H2/integrase_DNA-bd. 3 hits. |
| KO | K09193. |
| Pfam | PF00096. zf-C2H2. 3 hits. [Graphical view] |
| SMART | SM00355. ZnF_C2H2. 3 hits. [Graphical view] |
| PROSITE | PS00028. ZINC_FINGER_C2H2_1. 3 hits. PS50157. ZINC_FINGER_C2H2_2. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 26005. |
| PMAP-CutDB | Q02447. |
| SOURCE | Search... |
Entry information
| Entry name | SP3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q02447 Secondary accession number(s): A0AVL9 Q9BQR1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with