Q02357 (ANK1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 120.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ankyrin-1 Short name=ANK-1 Alternative name(s): Erythrocyte ankyrin | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1862 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Attaches integral membrane proteins to cytoskeletal elements; binds to the erythrocyte membrane protein band 4.2, to Na-K ATPase, to the lymphocyte membrane protein GP85, and to the cytoskeletal proteins fodrin, tubulin, vimentin and desmin. Erythrocyte ankyrins also link spectrin (beta chain) to the cytoplasmic domain of the erythrocytes anion exchange protein; they retain most or all of these binding functions. In skeletal muscle, isoform Mu7 together with obscurin may provide a molecular link between the sarcoplasmic reticulum and myofibrils. |
| Subunit structure | Interacts with a number of integral membrane proteins and cytoskeletal proteins. Interacts (via N-terminus) with SPTB/spectrin (beta chain). Interacts (via N-terminus ANK repeats) with SLC4A1/erythrocyte membrane protein band 3 (via cytoplasmic N-terminus). Also interacts with TTN/titin. Isoform Mu17 interacts with OBSCN isoform 3/obscurin. Interacts with HIF1AN By similarity. |
| Subcellular location | Isoform Er1: Cytoplasm › cytoskeleton By similarity. Note: Probably the other erythrocyte (Er) isoforms, are located near the surface of erythrocytic plasma membrane By similarity. Ref.3 Ref.8 Isoform Mu7: Membrane By similarity Ref.3 Ref.8. Isoform Mu8: Sarcoplasmic reticulum By similarity Ref.3 Ref.8. |
| Domain | The 55 kDa regulatory domain is involved in regulating binding of SPTB/spectrin (beta chain) and SLC4A1/erythrocyte membrane protein band 3 By similarity. The ANK repeat region forms a spiral around a large central cavity and is involved in binding of ion transporters By similarity. The tandem configuration of the two ZU5 and the UPA domains forms a structural supramodule termed ZZU. ZU5-1 mediates interaction with beta-spectrin, and the ZU5-1/UPA interface is required for ankyrin's function other than binding to spectrin By similarity. |
| Post-translational modification | Regulated by phosphorylation By similarity. Acylated by palmitic acid group(s) By similarity. Hydroxylated by HIF1AN at several asparagine and 1 aspartate residue within ANK repeat region; hydroxylation seems to increase the conformational stability of this region and may also modulate protein-protein interactions mediated by the ANK repeat region By similarity. |
| Sequence similarities | Contains 23 ANK repeats. Contains 1 death domain. Contains 2 ZU5 domains. |
Ontologies
Alternative products
| This entry describes 8 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform Er1 (identifier: Q02357-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform Br2 (identifier: Q02357-2) Also known as: Cb14/11; The sequence of this isoform differs from the canonical sequence as follows: 1-5: MGFCK → MAERPRRSGSDPA 817-817: G → GTAHISIMG 1636-1665: Missing. | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er3 (identifier: Q02357-3) Also known as: Er18; The sequence of this isoform differs from the canonical sequence as follows: 1832-1862: ELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ → IVEGPLADPGDLEADIESFMKLTKDHTSTPKP | ||||||
| Note: Incomplete sequence. Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Br4 (identifier: Q02357-4) Also known as: Cb12; The sequence of this isoform differs from the canonical sequence as follows: 1831-1831: V → VIVEGPLADPGDLEADIESFMKLTKV | ||||||
| Note: Incomplete sequence. Produced by alternative splicing of isoform Er1. | ||||||
| Isoform 5 (identifier: Q02357-5) The sequence of this isoform differs from the canonical sequence as follows: 1-4: MGFC → MAQAAKQLKKIKDIEAQALQEQKEKEESNRKRRNRSRDRKK 1510-1664: Missing. | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform 6 (identifier: Q02357-6) The sequence of this isoform differs from the canonical sequence as follows: 1-4: MGFC → MAQAAKQLKKIKDIEAQALQEQKEKEESNRKRRNRSRDRKK 817-817: G → GTAHISIMG | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Mu7 (identifier: Q02357-7) Also known as: skAnk1; The sequence of this isoform differs from the canonical sequence as follows: 1-1707: Missing. 1708-1780: SSWQEEVTQG...PESAFSQEVQ → MWTFITQLLV...RVVRRRVFLK | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform Mu8 (identifier: Q02357-8) The sequence of this isoform differs from the canonical sequence as follows: 1-1707: Missing. 1708-1780: SSWQEEVTQG...PESAFSQEVQ → MWTFITQLLV...RVVRRRVFLK 1832-1862: ELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ → IVEGPLADPGDLEADIESFMKLTKDHTSTPKP | ||||||
| Note: Produced by alternative splicing of isoform Mu7. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1862 | 1862 | Ankyrin-1 | PRO_0000066884 | |||||
Regions | |||||||||
| Repeat | 40 – 69 | 30 | ANK 1 | ||||||
| Repeat | 73 – 102 | 30 | ANK 2 | ||||||
| Repeat | 106 – 135 | 30 | ANK 3 | ||||||
| Repeat | 139 – 168 | 30 | ANK 4 | ||||||
| Repeat | 170 – 197 | 28 | ANK 5 | ||||||
| Repeat | 201 – 230 | 30 | ANK 6 | ||||||
| Repeat | 234 – 263 | 30 | ANK 7 | ||||||
| Repeat | 267 – 296 | 30 | ANK 8 | ||||||
| Repeat | 300 – 329 | 30 | ANK 9 | ||||||
| Repeat | 333 – 362 | 30 | ANK 10 | ||||||
| Repeat | 366 – 395 | 30 | ANK 11 | ||||||
| Repeat | 399 – 428 | 30 | ANK 12 | ||||||
| Repeat | 432 – 461 | 30 | ANK 13 | ||||||
| Repeat | 465 – 494 | 30 | ANK 14 | ||||||
| Repeat | 498 – 527 | 30 | ANK 15 | ||||||
| Repeat | 531 – 560 | 30 | ANK 16 | ||||||
| Repeat | 564 – 593 | 30 | ANK 17 | ||||||
| Repeat | 597 – 626 | 30 | ANK 18 | ||||||
| Repeat | 630 – 659 | 30 | ANK 19 | ||||||
| Repeat | 663 – 692 | 30 | ANK 20 | ||||||
| Repeat | 696 – 725 | 30 | ANK 21 | ||||||
| Repeat | 729 – 758 | 30 | ANK 22 | ||||||
| Repeat | 762 – 791 | 30 | ANK 23 | ||||||
| Domain | 907 – 1032 | 126 | ZU5 1 | ||||||
| Domain | 1033 – 1196 | 164 | ZU5 2 | ||||||
| Domain | 1399 – 1483 | 85 | Death | ||||||
| Region | 1 – 827 | 827 | 89 kDa domain | ||||||
| Region | 1197 – 1331 | 135 | UPA domain By similarity | ||||||
| Region | 1387 – 1862 | 476 | 55 kDa regulatory domain | ||||||
Amino acid modifications | |||||||||
| Modified residue | 101 | 1 | (3S)-3-hydroxyasparagine; by HIF1AN; partial Ref.7 | ||||||
| Modified residue | 229 | 1 | (3S)-3-hydroxyasparagine; by HIF1AN By similarity | ||||||
| Modified residue | 427 | 1 | (3S)-3-hydroxyasparagine; by HIF1AN By similarity | ||||||
| Modified residue | 460 | 1 | (3S)-3-hydroxyasparagine; by HIF1AN By similarity | ||||||
| Modified residue | 625 | 1 | (3S)-3-hydroxyasparagine; by HIF1AN By similarity | ||||||
| Modified residue | 658 | 1 | (3S)-3-hydroxyasparagine; by HIF1AN By similarity | ||||||
| Modified residue | 691 | 1 | (3S)-3-hydroxyaspartate; by HIF1AN By similarity | ||||||
| Modified residue | 724 | 1 | (3S)-3-hydroxyasparagine; by HIF1AN By similarity | ||||||
| Modified residue | 757 | 1 | (3S)-3-hydroxyasparagine; by HIF1AN By similarity | ||||||
| Modified residue | 852 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 862 | 1 | Phosphothreonine Ref.9 | ||||||
| Modified residue | 1069 | 1 | Phosphotyrosine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 1707 | 1707 | Missing in isoform Mu7 and isoform Mu8. | VSP_018452 | |||||
| Alternative sequence | 1 – 5 | 5 | MGFCK → MAERPRRSGSDPA in isoform Br2. | VSP_018453 | |||||
| Alternative sequence | 1 – 4 | 4 | MGFC → MAQAAKQLKKIKDIEAQALQ EQKEKEESNRKRRNRSRDRK K in isoform 5 and isoform 6. | VSP_018454 | |||||
| Alternative sequence | 817 | 1 | G → GTAHISIMG in isoform Br2 and isoform 6. | VSP_018455 | |||||
| Alternative sequence | 1510 – 1664 | 155 | Missing in isoform 5. | VSP_018456 | |||||
| Alternative sequence | 1636 – 1665 | 30 | Missing in isoform Br2. | VSP_018457 | |||||
| Alternative sequence | 1708 – 1780 | 73 | SSWQE…SQEVQ → MWTFITQLLVTLVLLGFFLV SCQNVMHIVKGSLCFVLKHI HQELDKELGESEGLSDDEET ISTRVVRRRVFLK in isoform Mu7 and isoform Mu8. | VSP_018458 | |||||
| Alternative sequence | 1831 | 1 | V → VIVEGPLADPGDLEADIESF MKLTKV in isoform Br4. | VSP_018459 | |||||
| Alternative sequence | 1832 – 1862 | 31 | ELRGS…KRGKQ → IVEGPLADPGDLEADIESFM KLTKDHTSTPKP in isoform Er3 and isoform Mu8. | VSP_018460 | |||||
Experimental info | |||||||||
| Sequence conflict | 507 | 1 | A → T in BAE34375. Ref.3 | ||||||
| Sequence conflict | 678 | 1 | P → L in AAA37236. Ref.1 | ||||||
| Sequence conflict | 818 | 1 | D → G in BAE34375. Ref.3 | ||||||
| Sequence conflict | 1098 | 1 | K → N in CAA48801. Ref.2 | ||||||
| Sequence conflict | 1481 | 1 | G → V in CAA48801. Ref.2 | ||||||
| Sequence conflict | 1541 | 1 | T → A in BAE27815. Ref.3 | ||||||
| Sequence conflict | 1541 | 1 | T → A in BAE28015. Ref.3 | ||||||
| Sequence conflict | 1644 | 1 | K → R in BAE28015. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Murine erythrocyte ankyrin cDNA: highly conserved regions of the regulatory domain." White R.A., Birkenmeier C.S., Peters L.L., Barker J.E., Lux S.E. Mamm. Genome 3:281-285(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ER1). Tissue: Erythrocyte. |
| [2] | "Complex patterns of sequence variation and multiple 5' and 3' ends are found among transcripts of the erythroid ankyrin gene." Birkenmeier C.S., White R.A., Peters L.L., Hall E.J., Lux S.E., Barker J.E. J. Biol. Chem. 268:9533-9540(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BR2; ER3 AND BR4). Strain: C57BL/6J. Tissue: Cerebellum. |
| [3] | "An alternative first exon in the distal end of the erythroid ankyrin gene leads to production of a small isoform containing an NH2-terminal membrane anchor." Birkenmeier C.S., Sharp J.J., Gifford E.J., Deveau S.A., Barker J.E. Genomics 50:79-88(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM MU7), TISSUE SPECIFICITY, SUBCELLULAR LOCATION. Strain: C57BL/6J. Tissue: Skeletal muscle. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS BR2; 5; 6 AND MU8). Strain: C57BL/6J. Tissue: Forelimb and Inner ear. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MU7). Tissue: Heart and Lung. |
| [6] | Birkenmeier C.B., Sharp J.J., Hall E.J., Deveau S.A., Barker J.E. Submitted (OCT-1996) to the EMBL/GenBank/DDBJ databases Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: C57BL/6J. |
| [7] | "Asparagine and aspartate hydroxylation of the cytoskeletal ankyrin family is catalyzed by factor-inhibiting hypoxia-inducible factor." Yang M., Ge W., Chowdhury R., Claridge T.D., Kramer H.B., Schmierer B., McDonough M.A., Gong L., Kessler B.M., Ratcliffe P.J., Coleman M.L., Schofield C.J. J. Biol. Chem. 286:7648-7660(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 95-106, HYDROXYLATION AT ASN-101. |
| [8] | "Small, membrane-bound, alternatively spliced forms of ankyrin 1 associated with the sarcoplasmic reticulum of mammalian skeletal muscle." Zhou D., Birkenmeier C.S., Williams M.W., Sharp J.J., Barker J.E., Bloch R.J. J. Cell Biol. 136:621-631(1997) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [9] | "Comprehensive identification of phosphorylation sites in postsynaptic density preparations." Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L. Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-852 AND THR-862, MASS SPECTROMETRY. Tissue: Brain. |
| [10] | "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain." Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P. J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-1069, MASS SPECTROMETRY. Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M84756 mRNA. Translation: AAA37236.1. X69063 mRNA. Translation: CAA48801.1. X69064 mRNA. Translation: CAA48802.1. U73972 mRNA. Translation: AAC24156.1. AK134267 mRNA. Translation: BAE22074.1. AK147278 mRNA. Translation: BAE27815.1. AK147597 mRNA. Translation: BAE28015.1. AK158131 mRNA. Translation: BAE34375.1. BC061219 mRNA. Translation: AAH61219.1. U76758 Genomic DNA. Translation: AAB37323.1. U76758 Genomic DNA. Translation: AAB37324.1. U76758 Genomic DNA. Translation: AAB37325.1. |
| IPI | IPI00109307. IPI00119871. IPI00474771. IPI00755019. IPI00755395. IPI00755993. IPI00757184. IPI00874807. |
| PIR | I49502. S37771. S37772. |
| RefSeq | NP_001104253.1. NM_001110783.1. NP_112435.2. NM_031158.2. |
| UniGene | Mm.334444. |
3D structure databases | |
| ProteinModelPortal | Q02357. |
| SMR | Q02357. Positions 7-808, 907-1493. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-255055. |
PTM databases | |
| PhosphoSite | Q02357. |
Proteomic databases | |
| PaxDb | Q02357. |
| PRIDE | Q02357. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000033947; ENSMUSP00000033947; ENSMUSG00000031543. ENSMUST00000110688; ENSMUSP00000106316; ENSMUSG00000031543. ENSMUST00000121075; ENSMUSP00000112966; ENSMUSG00000031543. ENSMUST00000121802; ENSMUSP00000113571; ENSMUSG00000031543. |
| GeneID | 11733. |
| KEGG | mmu:11733. |
| UCSC | uc009lee.2. mouse. uc009lef.2. mouse. uc009leg.1. mouse. uc009lei.1. mouse. uc009lel.1. mouse. uc009lem.1. mouse. |
Organism-specific databases | |
| CTD | 286. |
| MGI | MGI:88024. Ank1. |
Phylogenomic databases | |
| eggNOG | COG0666. |
| GeneTree | ENSGT00700000104348. |
| HOVERGEN | HBG004234. |
| KO | K10380. |
Gene expression databases | |
| ArrayExpress | Q02357. |
| Bgee | Q02357. |
| CleanEx | MM_ANK1. |
| Genevestigator | Q02357. |
| GermOnline | ENSMUSG00000031543. Mus musculus. |
Family and domain databases | |
| Gene3D | 1.10.533.10. 1 hit. 1.25.40.20. 3 hits. |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR011029. DEATH-like_dom. IPR000488. Death_domain. IPR000906. ZU5. [Graphical view] |
| Pfam | PF00023. Ank. 3 hits. PF12796. Ank_2. 8 hits. PF00531. Death. 1 hit. PF00791. ZU5. 1 hit. [Graphical view] |
| PRINTS | PR01415. ANKYRIN. |
| SMART | SM00248. ANK. 23 hits. SM00005. DEATH. 1 hit. SM00218. ZU5. 1 hit. [Graphical view] |
| SUPFAM | SSF48403. ANK. 2 hits. SSF47986. DEATH_like. 1 hit. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 20 hits. PS50017. DEATH_DOMAIN. 1 hit. PS51145. ZU5. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 279431. |
| SOURCE | Search... |
Entry information
| Entry name | ANK1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q02357 Secondary accession number(s): P70440 Q78E45 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
