Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q02357

- ANK1_MOUSE

UniProt

Q02357 - ANK1_MOUSE

Protein

Ankyrin-1

Gene

Ank1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 2 (16 May 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Attaches integral membrane proteins to cytoskeletal elements; binds to the erythrocyte membrane protein band 4.2, to Na-K ATPase, to the lymphocyte membrane protein GP85, and to the cytoskeletal proteins fodrin, tubulin, vimentin and desmin. Erythrocyte ankyrins also link spectrin (beta chain) to the cytoplasmic domain of the erythrocytes anion exchange protein; they retain most or all of these binding functions. In skeletal muscle, isoform Mu7 together with obscurin may provide a molecular link between the sarcoplasmic reticulum and myofibrils.

    GO - Biological processi

    1. ER to Golgi vesicle-mediated transport Source: Ensembl
    2. erythrocyte development Source: MGI
    3. monovalent inorganic cation transport Source: MGI
    4. porphyrin-containing compound biosynthetic process Source: MGI
    5. positive regulation of organelle organization Source: Ensembl
    6. protein targeting to plasma membrane Source: Ensembl
    7. signal transduction Source: InterPro

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ankyrin-1
    Short name:
    ANK-1
    Alternative name(s):
    Erythrocyte ankyrin
    Gene namesi
    Name:Ank1
    Synonyms:Ank-1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 8

    Organism-specific databases

    MGIiMGI:88024. Ank1.

    Subcellular locationi

    Isoform Er1 : Cytoplasmcytoskeleton By similarity
    Note: Probably the other erythrocyte (Er) isoforms, are located near the surface of erythrocytic plasma membrane.By similarity
    Isoform Mu7 : Membrane By similarity

    GO - Cellular componenti

    1. axolemma Source: Ensembl
    2. cortical cytoskeleton Source: MGI
    3. M band Source: Ensembl
    4. membrane Source: MGI
    5. nucleus Source: Ensembl
    6. postsynaptic membrane Source: Ensembl
    7. sarcolemma Source: Ensembl
    8. sarcoplasmic reticulum Source: UniProtKB-SubCell
    9. spectrin-associated cytoskeleton Source: MGI
    10. Z disc Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton, Membrane, Sarcoplasmic reticulum

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 18621862Ankyrin-1PRO_0000066884Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei101 – 1011(3S)-3-hydroxyasparagine; by HIF1AN; partial1 Publication
    Modified residuei229 – 2291(3S)-3-hydroxyasparagine; by HIF1ANBy similarity
    Modified residuei427 – 4271(3S)-3-hydroxyasparagine; by HIF1ANBy similarity
    Modified residuei460 – 4601(3S)-3-hydroxyasparagine; by HIF1ANBy similarity
    Modified residuei625 – 6251(3S)-3-hydroxyasparagine; by HIF1ANBy similarity
    Modified residuei658 – 6581(3S)-3-hydroxyasparagine; by HIF1ANBy similarity
    Modified residuei691 – 6911(3S)-3-hydroxyaspartate; by HIF1ANBy similarity
    Modified residuei724 – 7241(3S)-3-hydroxyasparagine; by HIF1ANBy similarity
    Modified residuei757 – 7571(3S)-3-hydroxyasparagine; by HIF1ANBy similarity
    Modified residuei852 – 8521Phosphoserine1 Publication
    Modified residuei862 – 8621Phosphothreonine1 Publication
    Modified residuei957 – 9571Phosphothreonine1 Publication
    Modified residuei1069 – 10691Phosphotyrosine1 Publication
    Modified residuei1388 – 13881Phosphoserine1 Publication

    Post-translational modificationi

    Regulated by phosphorylation.By similarity
    Acylated by palmitic acid group(s).By similarity
    Hydroxylated by HIF1AN at several asparagine and 1 aspartate residue within ANK repeat region; hydroxylation seems to increase the conformational stability of this region and may also modulate protein-protein interactions mediated by the ANK repeat region.By similarity

    Keywords - PTMi

    Hydroxylation, Lipoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ02357.
    PaxDbiQ02357.
    PRIDEiQ02357.

    PTM databases

    PhosphoSiteiQ02357.

    Expressioni

    Gene expression databases

    ArrayExpressiQ02357.
    BgeeiQ02357.
    CleanExiMM_ANK1.
    GenevestigatoriQ02357.

    Interactioni

    Subunit structurei

    Interacts with a number of integral membrane proteins and cytoskeletal proteins. Interacts (via N-terminus) with SPTB/spectrin (beta chain). Interacts (via N-terminus ANK repeats) with SLC4A1/erythrocyte membrane protein band 3 (via cytoplasmic N-terminus). Also interacts with TTN/titin. Isoform Mu17 interacts with OBSCN isoform 3/obscurin. Interacts with HIF1AN By similarity.By similarity

    Protein-protein interaction databases

    IntActiQ02357. 3 interactions.
    MINTiMINT-255055.

    Structurei

    3D structure databases

    ProteinModelPortaliQ02357.
    SMRiQ02357. Positions 7-808, 907-1493.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati40 – 6930ANK 1Add
    BLAST
    Repeati73 – 10230ANK 2Add
    BLAST
    Repeati106 – 13530ANK 3Add
    BLAST
    Repeati139 – 16830ANK 4Add
    BLAST
    Repeati170 – 19728ANK 5Add
    BLAST
    Repeati201 – 23030ANK 6Add
    BLAST
    Repeati234 – 26330ANK 7Add
    BLAST
    Repeati267 – 29630ANK 8Add
    BLAST
    Repeati300 – 32930ANK 9Add
    BLAST
    Repeati333 – 36230ANK 10Add
    BLAST
    Repeati366 – 39530ANK 11Add
    BLAST
    Repeati399 – 42830ANK 12Add
    BLAST
    Repeati432 – 46130ANK 13Add
    BLAST
    Repeati465 – 49430ANK 14Add
    BLAST
    Repeati498 – 52730ANK 15Add
    BLAST
    Repeati531 – 56030ANK 16Add
    BLAST
    Repeati564 – 59330ANK 17Add
    BLAST
    Repeati597 – 62630ANK 18Add
    BLAST
    Repeati630 – 65930ANK 19Add
    BLAST
    Repeati663 – 69230ANK 20Add
    BLAST
    Repeati696 – 72530ANK 21Add
    BLAST
    Repeati729 – 75830ANK 22Add
    BLAST
    Repeati762 – 79130ANK 23Add
    BLAST
    Domaini907 – 1032126ZU5 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1033 – 1196164ZU5 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1399 – 148385DeathPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 82782789 kDa domainAdd
    BLAST
    Regioni1197 – 1331135UPA domainBy similarityAdd
    BLAST
    Regioni1387 – 186247655 kDa regulatory domainAdd
    BLAST

    Domaini

    The 55 kDa regulatory domain is involved in regulating binding of SPTB/spectrin (beta chain) and SLC4A1/erythrocyte membrane protein band 3.By similarity
    The ANK repeat region forms a spiral around a large central cavity and is involved in binding of ion transporters.By similarity
    The tandem configuration of the two ZU5 and the UPA domains forms a structural supramodule termed ZZU. ZU5-1 mediates interaction with beta-spectrin, and the ZU5-1/UPA interface is required for ankyrin's function other than binding to spectrin By similarity.By similarity

    Sequence similaritiesi

    Contains 23 ANK repeats.PROSITE-ProRule annotation
    Contains 1 death domain.PROSITE-ProRule annotation
    Contains 2 ZU5 domains.PROSITE-ProRule annotation

    Keywords - Domaini

    ANK repeat, Repeat

    Phylogenomic databases

    eggNOGiCOG0666.
    GeneTreeiENSGT00720000108655.
    HOVERGENiHBG004234.
    KOiK10380.
    OMAiYTIASEA.
    OrthoDBiEOG7P02H2.
    TreeFamiTF351263.

    Family and domain databases

    Gene3Di1.10.533.10. 1 hit.
    1.25.40.20. 3 hits.
    InterProiIPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR011029. DEATH-like_dom.
    IPR000488. Death_domain.
    IPR000906. ZU5.
    [Graphical view]
    PfamiPF00023. Ank. 3 hits.
    PF12796. Ank_2. 8 hits.
    PF00531. Death. 1 hit.
    PF00791. ZU5. 1 hit.
    [Graphical view]
    PRINTSiPR01415. ANKYRIN.
    SMARTiSM00248. ANK. 23 hits.
    SM00005. DEATH. 1 hit.
    SM00218. ZU5. 1 hit.
    [Graphical view]
    SUPFAMiSSF47986. SSF47986. 1 hit.
    SSF48403. SSF48403. 2 hits.
    PROSITEiPS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 20 hits.
    PS50017. DEATH_DOMAIN. 1 hit.
    PS51145. ZU5. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative promoter usage and alternative splicing. Align

    Isoform Er1 (identifier: Q02357-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGFCKADAAT SFLRAARSGN LDKALDHLRN GVDINTCNQN GLNGLHLASK     50
    EGHVKMVVEL LHKEIILETT TKKGNTALHI AALAGQDEVV RELVNYGANV 100
    NAQSQKGFTP LYMAAQENHL EVVKFLLENG ANQNVATEDG FTPLAVALQQ 150
    GHENVVAHLI NYGTKGKVRL PALHIAARND DTRTAAVLLQ NDPNPDVLSK 200
    TGFTPLHIAA HYENLNVAQL LLNRGASVNF TPQNGITPLH IASRRGNVIM 250
    VRLLLDRGAQ IETRTKDELT PLHCAARNGH VRISEILLDH GAPIQAKTKN 300
    GLSPIHMAAQ GDHLDCVRLL LQYNAEIDDI TLDHLTPLHV AAHCGHHRVA 350
    KVLLDKGAKP NSRALNGFTP LHIACKKNHI RVMELLLKTG ASIDAVTESG 400
    LTPLHVASFM GHLPIVKNLL QRGASPNVSN VKVETPLHMA ARAGHTEVAK 450
    YLLQNKAKAN AKAKDDQTPL HCAARIGHTG MVKLLLENGA SPNLATTAGH 500
    TPLHTAAREG HVDTALALLE KEASQACMTK KGFTPLHVAA KYGKVRLAEL 550
    LLEHDAHPNA AGKNGLTPLH VAVHHNNLDI VKLLLPRGGS PHSPAWNGYT 600
    PLHIAAKQNQ IEVARSLLQY GGSANAESVQ GVTPLHLAAQ EGHTEMVALL 650
    LSKQANGNLG NKSGLTPLHL VSQEGHVPVA DVLIKHGVTV DATTRMGYTP 700
    LHVASHYGNI KLVKFLLQHQ ADVNAKTKLG YSPLHQAAQQ GHTDIVTLLL 750
    KNGASPNEVS SNGTTPLAIA KRLGYISVTD VLKVVTDETS VVLVSDKHRM 800
    SYPETVDEIL DVSEDEGDEL VGSKAERRDS RDVGEEKELL DFVPKLDQVV 850
    ESPAIPRIPC VTPETVVIRS EDQEQASKEY DEDSLIPSSP ATETSDNISP 900
    VASPVHTGFL VSFMVDARGG SMRGSRHNGL RVVIPPRTCA APTRITCRLV 950
    KPQKLNTPPP LAEEEGLASR IIALGPTGAQ FLSPVIVEIP HFASHGRGDR 1000
    ELVVLRSENG SVWKEHKSRY GESYLDQILN GMDEELGSLE ELEKKRVCRI 1050
    ITTDFPLYFV IMSRLCQDYD TIGPEGGSLR SKLVPLVQAT FPENAVTKKV 1100
    KLALQAQPVP DELVTKLLGN QATFSPIVTV EPRRRKFHRP IGLRIPLPPS 1150
    WTDNPRDSGE GDTTSLRLLC SVIGGTDQAQ WEDITGTTKL IYANECANFT 1200
    TNVSARFWLS DCPRTAEAVH FATLLYKELT AVPYMAKFVI FAKMNDAREG 1250
    RLRCYCMTDD KVDKTLEQHE NFVEVARSRD IEVLEGMPLF AELSGNLVPV 1300
    KKAAQQRSFH FQSFRENRLA IPVKVRDSSR EPGGFLSFLR KTMKYEDTQH 1350
    ILCHLNITMP PCTKGSGAED RRRTLTPLTL RYSILSESRL GFTSDTDRVE 1400
    MRMAVIREHL GLSWAELARE LQFSVEDINR IRVENPNSLL DQSTALLTLW 1450
    VDREGENAKM ENLYTALRNI DRSEIVNMLE GSGRQSRNLK PERRHGDREY 1500
    SLSPSQVNGY SSLQDELLSP ASLQYALPSP LCADQYWNEV TVIDAIPLAA 1550
    TEHDTMLEMS DMQVWSAGLT PSLVTAEDSS LECSKAEDSD AIPEWKLEGA 1600
    HSEDTQGPEL GSQDLVEDDT VDSDATNGLA DLLGQEEGQR SEKKRQEVSG 1650
    TEQDTETEVS LVSGQQRVHA RITDSPSVRQ VLDRSQARTL DWDKQGSTAV 1700
    HPQEATQSSW QEEVTQGPHS FQRRITTIQG PEPGALQEYE QVLVSTREHV 1750
    QRGPPETGSP KAGKEPSLWA PESAFSQEVQ GDELQNIPGE QVTEEQFTDE 1800
    QGNIVTKKII RKVVRQVDSS GAIDTQQHEE VELRGSGLQP DLIEGRKGAQ 1850
    IVKRASLKRG KQ 1862

    Note: Produced by alternative promoter usage.

    Length:1,862
    Mass (Da):204,227
    Last modified:May 16, 2006 - v2
    Checksum:iB5F3EBB447C3485D
    GO
    Isoform Br2 (identifier: Q02357-2) [UniParc]FASTAAdd to Basket

    Also known as: Cb14/11

    The sequence of this isoform differs from the canonical sequence as follows:
         1-5: MGFCK → MAERPRRSGSDPA
         817-817: G → GTAHISIMG
         1636-1665: Missing.

    Note: Produced by alternative splicing of isoform Er1.

    Show »
    Length:1,848
    Mass (Da):202,549
    Checksum:iBF5A6FAA4DE9071A
    GO
    Isoform Er3 (identifier: Q02357-3) [UniParc]FASTAAdd to Basket

    Also known as: Er18

    The sequence of this isoform differs from the canonical sequence as follows:
         1832-1862: ELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ → IVEGPLADPGDLEADIESFMKLTKDHTSTPKP

    Note: Incomplete sequence. Produced by alternative splicing of isoform Er1.

    Show »
    Length:1,863
    Mass (Da):204,290
    Checksum:i54B9C9F6E47ECB68
    GO
    Isoform Br4 (identifier: Q02357-4) [UniParc]FASTAAdd to Basket

    Also known as: Cb12

    The sequence of this isoform differs from the canonical sequence as follows:
         1831-1831: V → VIVEGPLADPGDLEADIESFMKLTKV

    Note: Incomplete sequence. Produced by alternative splicing of isoform Er1.

    Show »
    Length:1,887
    Mass (Da):206,897
    Checksum:i1D67DB304BEE32D5
    GO
    Isoform 5 (identifier: Q02357-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-4: MGFC → MAQAAKQLKKIKDIEAQALQEQKEKEESNRKRRNRSRDRKK
         1510-1664: Missing.

    Note: Produced by alternative splicing of isoform Er1.

    Show »
    Length:1,744
    Mass (Da):192,033
    Checksum:i86F90F57AF6707A4
    GO
    Isoform 6 (identifier: Q02357-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-4: MGFC → MAQAAKQLKKIKDIEAQALQEQKEKEESNRKRRNRSRDRKK
         817-817: G → GTAHISIMG

    Note: Produced by alternative splicing of isoform Er1.

    Show »
    Length:1,907
    Mass (Da):209,548
    Checksum:i1BFB9FEE0C5CCFAC
    GO
    Isoform Mu7 (identifier: Q02357-7) [UniParc]FASTAAdd to Basket

    Also known as: skAnk1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1707: Missing.
         1708-1780: SSWQEEVTQG...PESAFSQEVQ → MWTFITQLLV...RVVRRRVFLK

    Note: Produced by alternative promoter usage.

    Show »
    Length:155
    Mass (Da):17,539
    Checksum:i304B0AC409407EA1
    GO
    Isoform Mu8 (identifier: Q02357-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1707: Missing.
         1708-1780: SSWQEEVTQG...PESAFSQEVQ → MWTFITQLLV...RVVRRRVFLK
         1832-1862: ELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ → IVEGPLADPGDLEADIESFMKLTKDHTSTPKP

    Note: Produced by alternative splicing of isoform Mu7.

    Show »
    Length:156
    Mass (Da):17,602
    Checksum:iC67C71179430485E
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti507 – 5071A → T in BAE34375. (PubMed:9628825)Curated
    Sequence conflicti678 – 6781P → L in AAA37236. (PubMed:1386265)Curated
    Sequence conflicti818 – 8181D → G in BAE34375. (PubMed:9628825)Curated
    Sequence conflicti1098 – 10981K → N in CAA48801. (PubMed:8486643)Curated
    Sequence conflicti1481 – 14811G → V in CAA48801. (PubMed:8486643)Curated
    Sequence conflicti1541 – 15411T → A in BAE27815. (PubMed:9628825)Curated
    Sequence conflicti1541 – 15411T → A in BAE28015. (PubMed:9628825)Curated
    Sequence conflicti1644 – 16441K → R in BAE28015. (PubMed:9628825)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 17071707Missing in isoform Mu7 and isoform Mu8. 3 PublicationsVSP_018452Add
    BLAST
    Alternative sequencei1 – 55MGFCK → MAERPRRSGSDPA in isoform Br2. 2 PublicationsVSP_018453
    Alternative sequencei1 – 44MGFC → MAQAAKQLKKIKDIEAQALQ EQKEKEESNRKRRNRSRDRK K in isoform 5 and isoform 6. 1 PublicationVSP_018454
    Alternative sequencei817 – 8171G → GTAHISIMG in isoform Br2 and isoform 6. 2 PublicationsVSP_018455
    Alternative sequencei1510 – 1664155Missing in isoform 5. 1 PublicationVSP_018456Add
    BLAST
    Alternative sequencei1636 – 166530Missing in isoform Br2. 2 PublicationsVSP_018457Add
    BLAST
    Alternative sequencei1708 – 178073SSWQE…SQEVQ → MWTFITQLLVTLVLLGFFLV SCQNVMHIVKGSLCFVLKHI HQELDKELGESEGLSDDEET ISTRVVRRRVFLK in isoform Mu7 and isoform Mu8. 3 PublicationsVSP_018458Add
    BLAST
    Alternative sequencei1831 – 18311V → VIVEGPLADPGDLEADIESF MKLTKV in isoform Br4. 1 PublicationVSP_018459
    Alternative sequencei1832 – 186231ELRGS…KRGKQ → IVEGPLADPGDLEADIESFM KLTKDHTSTPKP in isoform Er3 and isoform Mu8. 2 PublicationsVSP_018460Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M84756 mRNA. Translation: AAA37236.1.
    X69063 mRNA. Translation: CAA48801.1.
    X69064 mRNA. Translation: CAA48802.1.
    U73972 mRNA. Translation: AAC24156.1.
    AK134267 mRNA. Translation: BAE22074.1.
    AK147278 mRNA. Translation: BAE27815.1.
    AK147597 mRNA. Translation: BAE28015.1.
    AK158131 mRNA. Translation: BAE34375.1.
    BC061219 mRNA. Translation: AAH61219.1.
    U76758 Genomic DNA. Translation: AAB37323.1.
    U76758 Genomic DNA. Translation: AAB37324.1.
    U76758 Genomic DNA. Translation: AAB37325.1.
    CCDSiCCDS22187.1. [Q02357-2]
    CCDS52523.1. [Q02357-6]
    CCDS72099.1. [Q02357-5]
    CCDS72100.1. [Q02357-1]
    CCDS72101.1. [Q02357-4]
    PIRiI49502.
    S37771.
    S37772.
    RefSeqiNP_001104253.1. NM_001110783.3.
    NP_001264209.1. NM_001277280.2. [Q02357-5]
    NP_001264210.1. NM_001277281.2.
    NP_001264215.1. NM_001277286.2.
    NP_001264218.1. NM_001277289.2.
    NP_112435.2. NM_031158.4.
    XP_006509068.1. XM_006509005.1. [Q02357-8]
    XP_006509069.1. XM_006509006.1. [Q02357-7]
    UniGeneiMm.334444.

    Genome annotation databases

    EnsembliENSMUST00000033947; ENSMUSP00000033947; ENSMUSG00000031543. [Q02357-8]
    ENSMUST00000110688; ENSMUSP00000106316; ENSMUSG00000031543. [Q02357-5]
    ENSMUST00000121075; ENSMUSP00000112966; ENSMUSG00000031543. [Q02357-7]
    ENSMUST00000121802; ENSMUSP00000113571; ENSMUSG00000031543.
    GeneIDi11733.
    KEGGimmu:11733.
    UCSCiuc009lee.2. mouse. [Q02357-6]
    uc009lef.2. mouse. [Q02357-5]
    uc009lel.1. mouse. [Q02357-7]
    uc009lem.1. mouse. [Q02357-8]

    Keywords - Coding sequence diversityi

    Alternative promoter usage, Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M84756 mRNA. Translation: AAA37236.1 .
    X69063 mRNA. Translation: CAA48801.1 .
    X69064 mRNA. Translation: CAA48802.1 .
    U73972 mRNA. Translation: AAC24156.1 .
    AK134267 mRNA. Translation: BAE22074.1 .
    AK147278 mRNA. Translation: BAE27815.1 .
    AK147597 mRNA. Translation: BAE28015.1 .
    AK158131 mRNA. Translation: BAE34375.1 .
    BC061219 mRNA. Translation: AAH61219.1 .
    U76758 Genomic DNA. Translation: AAB37323.1 .
    U76758 Genomic DNA. Translation: AAB37324.1 .
    U76758 Genomic DNA. Translation: AAB37325.1 .
    CCDSi CCDS22187.1. [Q02357-2 ]
    CCDS52523.1. [Q02357-6 ]
    CCDS72099.1. [Q02357-5 ]
    CCDS72100.1. [Q02357-1 ]
    CCDS72101.1. [Q02357-4 ]
    PIRi I49502.
    S37771.
    S37772.
    RefSeqi NP_001104253.1. NM_001110783.3.
    NP_001264209.1. NM_001277280.2. [Q02357-5 ]
    NP_001264210.1. NM_001277281.2.
    NP_001264215.1. NM_001277286.2.
    NP_001264218.1. NM_001277289.2.
    NP_112435.2. NM_031158.4.
    XP_006509068.1. XM_006509005.1. [Q02357-8 ]
    XP_006509069.1. XM_006509006.1. [Q02357-7 ]
    UniGenei Mm.334444.

    3D structure databases

    ProteinModelPortali Q02357.
    SMRi Q02357. Positions 7-808, 907-1493.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q02357. 3 interactions.
    MINTi MINT-255055.

    PTM databases

    PhosphoSitei Q02357.

    Proteomic databases

    MaxQBi Q02357.
    PaxDbi Q02357.
    PRIDEi Q02357.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000033947 ; ENSMUSP00000033947 ; ENSMUSG00000031543 . [Q02357-8 ]
    ENSMUST00000110688 ; ENSMUSP00000106316 ; ENSMUSG00000031543 . [Q02357-5 ]
    ENSMUST00000121075 ; ENSMUSP00000112966 ; ENSMUSG00000031543 . [Q02357-7 ]
    ENSMUST00000121802 ; ENSMUSP00000113571 ; ENSMUSG00000031543 .
    GeneIDi 11733.
    KEGGi mmu:11733.
    UCSCi uc009lee.2. mouse. [Q02357-6 ]
    uc009lef.2. mouse. [Q02357-5 ]
    uc009lel.1. mouse. [Q02357-7 ]
    uc009lem.1. mouse. [Q02357-8 ]

    Organism-specific databases

    CTDi 286.
    MGIi MGI:88024. Ank1.

    Phylogenomic databases

    eggNOGi COG0666.
    GeneTreei ENSGT00720000108655.
    HOVERGENi HBG004234.
    KOi K10380.
    OMAi YTIASEA.
    OrthoDBi EOG7P02H2.
    TreeFami TF351263.

    Miscellaneous databases

    NextBioi 279431.
    PROi Q02357.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q02357.
    Bgeei Q02357.
    CleanExi MM_ANK1.
    Genevestigatori Q02357.

    Family and domain databases

    Gene3Di 1.10.533.10. 1 hit.
    1.25.40.20. 3 hits.
    InterProi IPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR011029. DEATH-like_dom.
    IPR000488. Death_domain.
    IPR000906. ZU5.
    [Graphical view ]
    Pfami PF00023. Ank. 3 hits.
    PF12796. Ank_2. 8 hits.
    PF00531. Death. 1 hit.
    PF00791. ZU5. 1 hit.
    [Graphical view ]
    PRINTSi PR01415. ANKYRIN.
    SMARTi SM00248. ANK. 23 hits.
    SM00005. DEATH. 1 hit.
    SM00218. ZU5. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47986. SSF47986. 1 hit.
    SSF48403. SSF48403. 2 hits.
    PROSITEi PS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 20 hits.
    PS50017. DEATH_DOMAIN. 1 hit.
    PS51145. ZU5. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Murine erythrocyte ankyrin cDNA: highly conserved regions of the regulatory domain."
      White R.A., Birkenmeier C.S., Peters L.L., Barker J.E., Lux S.E.
      Mamm. Genome 3:281-285(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ER1).
      Tissue: Erythrocyte.
    2. "Complex patterns of sequence variation and multiple 5' and 3' ends are found among transcripts of the erythroid ankyrin gene."
      Birkenmeier C.S., White R.A., Peters L.L., Hall E.J., Lux S.E., Barker J.E.
      J. Biol. Chem. 268:9533-9540(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BR2; ER3 AND BR4).
      Strain: C57BL/6J.
      Tissue: Cerebellum.
    3. "An alternative first exon in the distal end of the erythroid ankyrin gene leads to production of a small isoform containing an NH2-terminal membrane anchor."
      Birkenmeier C.S., Sharp J.J., Gifford E.J., Deveau S.A., Barker J.E.
      Genomics 50:79-88(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM MU7), TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
      Strain: C57BL/6J.
      Tissue: Skeletal muscle.
    4. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS BR2; 5; 6 AND MU8).
      Strain: C57BL/6J.
      Tissue: Forelimb and Inner ear.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MU7).
      Tissue: Heart and Lung.
    6. Birkenmeier C.B., Sharp J.J., Hall E.J., Deveau S.A., Barker J.E.
      Submitted (OCT-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA].
      Strain: C57BL/6J.
    7. "Asparagine and aspartate hydroxylation of the cytoskeletal ankyrin family is catalyzed by factor-inhibiting hypoxia-inducible factor."
      Yang M., Ge W., Chowdhury R., Claridge T.D., Kramer H.B., Schmierer B., McDonough M.A., Gong L., Kessler B.M., Ratcliffe P.J., Coleman M.L., Schofield C.J.
      J. Biol. Chem. 286:7648-7660(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 95-106, HYDROXYLATION AT ASN-101.
    8. "Small, membrane-bound, alternatively spliced forms of ankyrin 1 associated with the sarcoplasmic reticulum of mammalian skeletal muscle."
      Zhou D., Birkenmeier C.S., Williams M.W., Sharp J.J., Barker J.E., Bloch R.J.
      J. Cell Biol. 136:621-631(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    9. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
      Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
      Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-852 AND THR-862, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-957 AND SER-1388, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    11. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
      Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
      J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-1069, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.

    Entry informationi

    Entry nameiANK1_MOUSE
    AccessioniPrimary (citable) accession number: Q02357
    Secondary accession number(s): P70440
    , P97446, P97941, Q3TZ35, Q3UH42, Q3UHP2, Q3UYY7, Q61302, Q61303, Q78E45
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1995
    Last sequence update: May 16, 2006
    Last modified: October 1, 2014
    This is version 132 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3