SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q02357

- ANK1_MOUSE

UniProt

Q02357 - ANK1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Ankyrin-1

Gene
Ank1, Ank-1
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Attaches integral membrane proteins to cytoskeletal elements; binds to the erythrocyte membrane protein band 4.2, to Na-K ATPase, to the lymphocyte membrane protein GP85, and to the cytoskeletal proteins fodrin, tubulin, vimentin and desmin. Erythrocyte ankyrins also link spectrin (beta chain) to the cytoplasmic domain of the erythrocytes anion exchange protein; they retain most or all of these binding functions. In skeletal muscle, isoform Mu7 together with obscurin may provide a molecular link between the sarcoplasmic reticulum and myofibrils.

GO - Biological processi

  1. ER to Golgi vesicle-mediated transport Source: Ensembl
  2. erythrocyte development Source: MGI
  3. monovalent inorganic cation transport Source: MGI
  4. porphyrin-containing compound biosynthetic process Source: MGI
  5. positive regulation of organelle organization Source: Ensembl
  6. protein targeting to plasma membrane Source: Ensembl
  7. signal transduction Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin-1
Short name:
ANK-1
Alternative name(s):
Erythrocyte ankyrin
Gene namesi
Name:Ank1
Synonyms:Ank-1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 8

Organism-specific databases

MGIiMGI:88024. Ank1.

Subcellular locationi

Isoform Er1 : Cytoplasmcytoskeleton By similarity
Note: Probably the other erythrocyte (Er) isoforms, are located near the surface of erythrocytic plasma membrane By similarity.2 Publications
Isoform Mu7 : Membrane By similarity 2 Publications
Isoform Mu8 : Sarcoplasmic reticulum By similarity 2 Publications

GO - Cellular componenti

  1. axolemma Source: Ensembl
  2. cortical cytoskeleton Source: MGI
  3. M band Source: Ensembl
  4. membrane Source: MGI
  5. nucleus Source: Ensembl
  6. postsynaptic membrane Source: Ensembl
  7. sarcolemma Source: Ensembl
  8. sarcoplasmic reticulum Source: UniProtKB-SubCell
  9. spectrin-associated cytoskeleton Source: MGI
  10. Z disc Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Membrane, Sarcoplasmic reticulum

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 18621862Ankyrin-1PRO_0000066884Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei101 – 1011(3S)-3-hydroxyasparagine; by HIF1AN; partial1 Publication
Modified residuei229 – 2291(3S)-3-hydroxyasparagine; by HIF1AN By similarity
Modified residuei427 – 4271(3S)-3-hydroxyasparagine; by HIF1AN By similarity
Modified residuei460 – 4601(3S)-3-hydroxyasparagine; by HIF1AN By similarity
Modified residuei625 – 6251(3S)-3-hydroxyasparagine; by HIF1AN By similarity
Modified residuei658 – 6581(3S)-3-hydroxyasparagine; by HIF1AN By similarity
Modified residuei691 – 6911(3S)-3-hydroxyaspartate; by HIF1AN By similarity
Modified residuei724 – 7241(3S)-3-hydroxyasparagine; by HIF1AN By similarity
Modified residuei757 – 7571(3S)-3-hydroxyasparagine; by HIF1AN By similarity
Modified residuei852 – 8521Phosphoserine1 Publication
Modified residuei862 – 8621Phosphothreonine1 Publication
Modified residuei957 – 9571Phosphothreonine1 Publication
Modified residuei1069 – 10691Phosphotyrosine1 Publication
Modified residuei1388 – 13881Phosphoserine1 Publication

Post-translational modificationi

Regulated by phosphorylation By similarity.
Acylated by palmitic acid group(s) By similarity.
Hydroxylated by HIF1AN at several asparagine and 1 aspartate residue within ANK repeat region; hydroxylation seems to increase the conformational stability of this region and may also modulate protein-protein interactions mediated by the ANK repeat region By similarity.

Keywords - PTMi

Hydroxylation, Lipoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ02357.
PaxDbiQ02357.
PRIDEiQ02357.

PTM databases

PhosphoSiteiQ02357.

Expressioni

Gene expression databases

ArrayExpressiQ02357.
BgeeiQ02357.
CleanExiMM_ANK1.
GenevestigatoriQ02357.

Interactioni

Subunit structurei

Interacts with a number of integral membrane proteins and cytoskeletal proteins. Interacts (via N-terminus) with SPTB/spectrin (beta chain). Interacts (via N-terminus ANK repeats) with SLC4A1/erythrocyte membrane protein band 3 (via cytoplasmic N-terminus). Also interacts with TTN/titin. Isoform Mu17 interacts with OBSCN isoform 3/obscurin. Interacts with HIF1AN By similarity.

Protein-protein interaction databases

IntActiQ02357. 3 interactions.
MINTiMINT-255055.

Structurei

3D structure databases

ProteinModelPortaliQ02357.
SMRiQ02357. Positions 7-808, 907-1493.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati40 – 6930ANK 1Add
BLAST
Repeati73 – 10230ANK 2Add
BLAST
Repeati106 – 13530ANK 3Add
BLAST
Repeati139 – 16830ANK 4Add
BLAST
Repeati170 – 19728ANK 5Add
BLAST
Repeati201 – 23030ANK 6Add
BLAST
Repeati234 – 26330ANK 7Add
BLAST
Repeati267 – 29630ANK 8Add
BLAST
Repeati300 – 32930ANK 9Add
BLAST
Repeati333 – 36230ANK 10Add
BLAST
Repeati366 – 39530ANK 11Add
BLAST
Repeati399 – 42830ANK 12Add
BLAST
Repeati432 – 46130ANK 13Add
BLAST
Repeati465 – 49430ANK 14Add
BLAST
Repeati498 – 52730ANK 15Add
BLAST
Repeati531 – 56030ANK 16Add
BLAST
Repeati564 – 59330ANK 17Add
BLAST
Repeati597 – 62630ANK 18Add
BLAST
Repeati630 – 65930ANK 19Add
BLAST
Repeati663 – 69230ANK 20Add
BLAST
Repeati696 – 72530ANK 21Add
BLAST
Repeati729 – 75830ANK 22Add
BLAST
Repeati762 – 79130ANK 23Add
BLAST
Domaini907 – 1032126ZU5 1Add
BLAST
Domaini1033 – 1196164ZU5 2Add
BLAST
Domaini1399 – 148385DeathAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 82782789 kDa domainAdd
BLAST
Regioni1197 – 1331135UPA domain By similarityAdd
BLAST
Regioni1387 – 186247655 kDa regulatory domainAdd
BLAST

Domaini

The 55 kDa regulatory domain is involved in regulating binding of SPTB/spectrin (beta chain) and SLC4A1/erythrocyte membrane protein band 3 By similarity.
The ANK repeat region forms a spiral around a large central cavity and is involved in binding of ion transporters By similarity.
The tandem configuration of the two ZU5 and the UPA domains forms a structural supramodule termed ZZU. ZU5-1 mediates interaction with beta-spectrin, and the ZU5-1/UPA interface is required for ankyrin's function other than binding to spectrin By similarity.

Sequence similaritiesi

Contains 23 ANK repeats.
Contains 1 death domain.
Contains 2 ZU5 domains.

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiCOG0666.
GeneTreeiENSGT00720000108655.
HOVERGENiHBG004234.
KOiK10380.
OMAiYTIASEA.
OrthoDBiEOG7P02H2.
TreeFamiTF351263.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
1.25.40.20. 3 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011029. DEATH-like_dom.
IPR000488. Death_domain.
IPR000906. ZU5.
[Graphical view]
PfamiPF00023. Ank. 3 hits.
PF12796. Ank_2. 8 hits.
PF00531. Death. 1 hit.
PF00791. ZU5. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 23 hits.
SM00005. DEATH. 1 hit.
SM00218. ZU5. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
SSF48403. SSF48403. 2 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 20 hits.
PS50017. DEATH_DOMAIN. 1 hit.
PS51145. ZU5. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative promoter usage and alternative splicing. Align

Isoform Er1 (identifier: Q02357-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGFCKADAAT SFLRAARSGN LDKALDHLRN GVDINTCNQN GLNGLHLASK     50
EGHVKMVVEL LHKEIILETT TKKGNTALHI AALAGQDEVV RELVNYGANV 100
NAQSQKGFTP LYMAAQENHL EVVKFLLENG ANQNVATEDG FTPLAVALQQ 150
GHENVVAHLI NYGTKGKVRL PALHIAARND DTRTAAVLLQ NDPNPDVLSK 200
TGFTPLHIAA HYENLNVAQL LLNRGASVNF TPQNGITPLH IASRRGNVIM 250
VRLLLDRGAQ IETRTKDELT PLHCAARNGH VRISEILLDH GAPIQAKTKN 300
GLSPIHMAAQ GDHLDCVRLL LQYNAEIDDI TLDHLTPLHV AAHCGHHRVA 350
KVLLDKGAKP NSRALNGFTP LHIACKKNHI RVMELLLKTG ASIDAVTESG 400
LTPLHVASFM GHLPIVKNLL QRGASPNVSN VKVETPLHMA ARAGHTEVAK 450
YLLQNKAKAN AKAKDDQTPL HCAARIGHTG MVKLLLENGA SPNLATTAGH 500
TPLHTAAREG HVDTALALLE KEASQACMTK KGFTPLHVAA KYGKVRLAEL 550
LLEHDAHPNA AGKNGLTPLH VAVHHNNLDI VKLLLPRGGS PHSPAWNGYT 600
PLHIAAKQNQ IEVARSLLQY GGSANAESVQ GVTPLHLAAQ EGHTEMVALL 650
LSKQANGNLG NKSGLTPLHL VSQEGHVPVA DVLIKHGVTV DATTRMGYTP 700
LHVASHYGNI KLVKFLLQHQ ADVNAKTKLG YSPLHQAAQQ GHTDIVTLLL 750
KNGASPNEVS SNGTTPLAIA KRLGYISVTD VLKVVTDETS VVLVSDKHRM 800
SYPETVDEIL DVSEDEGDEL VGSKAERRDS RDVGEEKELL DFVPKLDQVV 850
ESPAIPRIPC VTPETVVIRS EDQEQASKEY DEDSLIPSSP ATETSDNISP 900
VASPVHTGFL VSFMVDARGG SMRGSRHNGL RVVIPPRTCA APTRITCRLV 950
KPQKLNTPPP LAEEEGLASR IIALGPTGAQ FLSPVIVEIP HFASHGRGDR 1000
ELVVLRSENG SVWKEHKSRY GESYLDQILN GMDEELGSLE ELEKKRVCRI 1050
ITTDFPLYFV IMSRLCQDYD TIGPEGGSLR SKLVPLVQAT FPENAVTKKV 1100
KLALQAQPVP DELVTKLLGN QATFSPIVTV EPRRRKFHRP IGLRIPLPPS 1150
WTDNPRDSGE GDTTSLRLLC SVIGGTDQAQ WEDITGTTKL IYANECANFT 1200
TNVSARFWLS DCPRTAEAVH FATLLYKELT AVPYMAKFVI FAKMNDAREG 1250
RLRCYCMTDD KVDKTLEQHE NFVEVARSRD IEVLEGMPLF AELSGNLVPV 1300
KKAAQQRSFH FQSFRENRLA IPVKVRDSSR EPGGFLSFLR KTMKYEDTQH 1350
ILCHLNITMP PCTKGSGAED RRRTLTPLTL RYSILSESRL GFTSDTDRVE 1400
MRMAVIREHL GLSWAELARE LQFSVEDINR IRVENPNSLL DQSTALLTLW 1450
VDREGENAKM ENLYTALRNI DRSEIVNMLE GSGRQSRNLK PERRHGDREY 1500
SLSPSQVNGY SSLQDELLSP ASLQYALPSP LCADQYWNEV TVIDAIPLAA 1550
TEHDTMLEMS DMQVWSAGLT PSLVTAEDSS LECSKAEDSD AIPEWKLEGA 1600
HSEDTQGPEL GSQDLVEDDT VDSDATNGLA DLLGQEEGQR SEKKRQEVSG 1650
TEQDTETEVS LVSGQQRVHA RITDSPSVRQ VLDRSQARTL DWDKQGSTAV 1700
HPQEATQSSW QEEVTQGPHS FQRRITTIQG PEPGALQEYE QVLVSTREHV 1750
QRGPPETGSP KAGKEPSLWA PESAFSQEVQ GDELQNIPGE QVTEEQFTDE 1800
QGNIVTKKII RKVVRQVDSS GAIDTQQHEE VELRGSGLQP DLIEGRKGAQ 1850
IVKRASLKRG KQ 1862

Note: Produced by alternative promoter usage.

Length:1,862
Mass (Da):204,227
Last modified:May 16, 2006 - v2
Checksum:iB5F3EBB447C3485D
GO
Isoform Br2 (identifier: Q02357-2) [UniParc]FASTAAdd to Basket

Also known as: Cb14/11

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MGFCK → MAERPRRSGSDPA
     817-817: G → GTAHISIMG
     1636-1665: Missing.

Note: Produced by alternative splicing of isoform Er1.

Show »
Length:1,848
Mass (Da):202,549
Checksum:iBF5A6FAA4DE9071A
GO
Isoform Er3 (identifier: Q02357-3) [UniParc]FASTAAdd to Basket

Also known as: Er18

The sequence of this isoform differs from the canonical sequence as follows:
     1832-1862: ELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ → IVEGPLADPGDLEADIESFMKLTKDHTSTPKP

Note: Incomplete sequence. Produced by alternative splicing of isoform Er1.

Show »
Length:1,863
Mass (Da):204,290
Checksum:i54B9C9F6E47ECB68
GO
Isoform Br4 (identifier: Q02357-4) [UniParc]FASTAAdd to Basket

Also known as: Cb12

The sequence of this isoform differs from the canonical sequence as follows:
     1831-1831: V → VIVEGPLADPGDLEADIESFMKLTKV

Note: Incomplete sequence. Produced by alternative splicing of isoform Er1.

Show »
Length:1,887
Mass (Da):206,897
Checksum:i1D67DB304BEE32D5
GO
Isoform 5 (identifier: Q02357-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MGFC → MAQAAKQLKKIKDIEAQALQEQKEKEESNRKRRNRSRDRKK
     1510-1664: Missing.

Note: Produced by alternative splicing of isoform Er1.

Show »
Length:1,744
Mass (Da):192,033
Checksum:i86F90F57AF6707A4
GO
Isoform 6 (identifier: Q02357-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MGFC → MAQAAKQLKKIKDIEAQALQEQKEKEESNRKRRNRSRDRKK
     817-817: G → GTAHISIMG

Note: Produced by alternative splicing of isoform Er1.

Show »
Length:1,907
Mass (Da):209,548
Checksum:i1BFB9FEE0C5CCFAC
GO
Isoform Mu7 (identifier: Q02357-7) [UniParc]FASTAAdd to Basket

Also known as: skAnk1

The sequence of this isoform differs from the canonical sequence as follows:
     1-1707: Missing.
     1708-1780: SSWQEEVTQG...PESAFSQEVQ → MWTFITQLLV...RVVRRRVFLK

Note: Produced by alternative promoter usage.

Show »
Length:155
Mass (Da):17,539
Checksum:i304B0AC409407EA1
GO
Isoform Mu8 (identifier: Q02357-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1707: Missing.
     1708-1780: SSWQEEVTQG...PESAFSQEVQ → MWTFITQLLV...RVVRRRVFLK
     1832-1862: ELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ → IVEGPLADPGDLEADIESFMKLTKDHTSTPKP

Note: Produced by alternative splicing of isoform Mu7.

Show »
Length:156
Mass (Da):17,602
Checksum:iC67C71179430485E
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 17071707Missing in isoform Mu7 and isoform Mu8. VSP_018452Add
BLAST
Alternative sequencei1 – 55MGFCK → MAERPRRSGSDPA in isoform Br2. VSP_018453
Alternative sequencei1 – 44MGFC → MAQAAKQLKKIKDIEAQALQ EQKEKEESNRKRRNRSRDRK K in isoform 5 and isoform 6. VSP_018454
Alternative sequencei817 – 8171G → GTAHISIMG in isoform Br2 and isoform 6. VSP_018455
Alternative sequencei1510 – 1664155Missing in isoform 5. VSP_018456Add
BLAST
Alternative sequencei1636 – 166530Missing in isoform Br2. VSP_018457Add
BLAST
Alternative sequencei1708 – 178073SSWQE…SQEVQ → MWTFITQLLVTLVLLGFFLV SCQNVMHIVKGSLCFVLKHI HQELDKELGESEGLSDDEET ISTRVVRRRVFLK in isoform Mu7 and isoform Mu8. VSP_018458Add
BLAST
Alternative sequencei1831 – 18311V → VIVEGPLADPGDLEADIESF MKLTKV in isoform Br4. VSP_018459
Alternative sequencei1832 – 186231ELRGS…KRGKQ → IVEGPLADPGDLEADIESFM KLTKDHTSTPKP in isoform Er3 and isoform Mu8. VSP_018460Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti507 – 5071A → T in BAE34375. 1 Publication
Sequence conflicti678 – 6781P → L in AAA37236. 1 Publication
Sequence conflicti818 – 8181D → G in BAE34375. 1 Publication
Sequence conflicti1098 – 10981K → N in CAA48801. 1 Publication
Sequence conflicti1481 – 14811G → V in CAA48801. 1 Publication
Sequence conflicti1541 – 15411T → A in BAE27815. 1 Publication
Sequence conflicti1541 – 15411T → A in BAE28015. 1 Publication
Sequence conflicti1644 – 16441K → R in BAE28015. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M84756 mRNA. Translation: AAA37236.1.
X69063 mRNA. Translation: CAA48801.1.
X69064 mRNA. Translation: CAA48802.1.
U73972 mRNA. Translation: AAC24156.1.
AK134267 mRNA. Translation: BAE22074.1.
AK147278 mRNA. Translation: BAE27815.1.
AK147597 mRNA. Translation: BAE28015.1.
AK158131 mRNA. Translation: BAE34375.1.
BC061219 mRNA. Translation: AAH61219.1.
U76758 Genomic DNA. Translation: AAB37323.1.
U76758 Genomic DNA. Translation: AAB37324.1.
U76758 Genomic DNA. Translation: AAB37325.1.
CCDSiCCDS22187.1. [Q02357-2]
CCDS52523.1. [Q02357-6]
CCDS72099.1. [Q02357-5]
CCDS72100.1. [Q02357-1]
CCDS72101.1. [Q02357-4]
PIRiI49502.
S37771.
S37772.
RefSeqiNP_001104253.1. NM_001110783.3.
NP_001264209.1. NM_001277280.2. [Q02357-5]
NP_001264210.1. NM_001277281.2.
NP_001264215.1. NM_001277286.2.
NP_001264218.1. NM_001277289.2.
NP_112435.2. NM_031158.4.
XP_006509068.1. XM_006509005.1. [Q02357-8]
XP_006509069.1. XM_006509006.1. [Q02357-7]
UniGeneiMm.334444.

Genome annotation databases

EnsembliENSMUST00000033947; ENSMUSP00000033947; ENSMUSG00000031543. [Q02357-8]
ENSMUST00000110688; ENSMUSP00000106316; ENSMUSG00000031543. [Q02357-5]
ENSMUST00000121075; ENSMUSP00000112966; ENSMUSG00000031543. [Q02357-7]
ENSMUST00000121802; ENSMUSP00000113571; ENSMUSG00000031543.
GeneIDi11733.
KEGGimmu:11733.
UCSCiuc009lee.2. mouse. [Q02357-6]
uc009lef.2. mouse. [Q02357-5]
uc009lel.1. mouse. [Q02357-7]
uc009lem.1. mouse. [Q02357-8]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M84756 mRNA. Translation: AAA37236.1 .
X69063 mRNA. Translation: CAA48801.1 .
X69064 mRNA. Translation: CAA48802.1 .
U73972 mRNA. Translation: AAC24156.1 .
AK134267 mRNA. Translation: BAE22074.1 .
AK147278 mRNA. Translation: BAE27815.1 .
AK147597 mRNA. Translation: BAE28015.1 .
AK158131 mRNA. Translation: BAE34375.1 .
BC061219 mRNA. Translation: AAH61219.1 .
U76758 Genomic DNA. Translation: AAB37323.1 .
U76758 Genomic DNA. Translation: AAB37324.1 .
U76758 Genomic DNA. Translation: AAB37325.1 .
CCDSi CCDS22187.1. [Q02357-2 ]
CCDS52523.1. [Q02357-6 ]
CCDS72099.1. [Q02357-5 ]
CCDS72100.1. [Q02357-1 ]
CCDS72101.1. [Q02357-4 ]
PIRi I49502.
S37771.
S37772.
RefSeqi NP_001104253.1. NM_001110783.3.
NP_001264209.1. NM_001277280.2. [Q02357-5 ]
NP_001264210.1. NM_001277281.2.
NP_001264215.1. NM_001277286.2.
NP_001264218.1. NM_001277289.2.
NP_112435.2. NM_031158.4.
XP_006509068.1. XM_006509005.1. [Q02357-8 ]
XP_006509069.1. XM_006509006.1. [Q02357-7 ]
UniGenei Mm.334444.

3D structure databases

ProteinModelPortali Q02357.
SMRi Q02357. Positions 7-808, 907-1493.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q02357. 3 interactions.
MINTi MINT-255055.

PTM databases

PhosphoSitei Q02357.

Proteomic databases

MaxQBi Q02357.
PaxDbi Q02357.
PRIDEi Q02357.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000033947 ; ENSMUSP00000033947 ; ENSMUSG00000031543 . [Q02357-8 ]
ENSMUST00000110688 ; ENSMUSP00000106316 ; ENSMUSG00000031543 . [Q02357-5 ]
ENSMUST00000121075 ; ENSMUSP00000112966 ; ENSMUSG00000031543 . [Q02357-7 ]
ENSMUST00000121802 ; ENSMUSP00000113571 ; ENSMUSG00000031543 .
GeneIDi 11733.
KEGGi mmu:11733.
UCSCi uc009lee.2. mouse. [Q02357-6 ]
uc009lef.2. mouse. [Q02357-5 ]
uc009lel.1. mouse. [Q02357-7 ]
uc009lem.1. mouse. [Q02357-8 ]

Organism-specific databases

CTDi 286.
MGIi MGI:88024. Ank1.

Phylogenomic databases

eggNOGi COG0666.
GeneTreei ENSGT00720000108655.
HOVERGENi HBG004234.
KOi K10380.
OMAi YTIASEA.
OrthoDBi EOG7P02H2.
TreeFami TF351263.

Miscellaneous databases

NextBioi 279431.
PROi Q02357.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q02357.
Bgeei Q02357.
CleanExi MM_ANK1.
Genevestigatori Q02357.

Family and domain databases

Gene3Di 1.10.533.10. 1 hit.
1.25.40.20. 3 hits.
InterProi IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011029. DEATH-like_dom.
IPR000488. Death_domain.
IPR000906. ZU5.
[Graphical view ]
Pfami PF00023. Ank. 3 hits.
PF12796. Ank_2. 8 hits.
PF00531. Death. 1 hit.
PF00791. ZU5. 1 hit.
[Graphical view ]
PRINTSi PR01415. ANKYRIN.
SMARTi SM00248. ANK. 23 hits.
SM00005. DEATH. 1 hit.
SM00218. ZU5. 1 hit.
[Graphical view ]
SUPFAMi SSF47986. SSF47986. 1 hit.
SSF48403. SSF48403. 2 hits.
PROSITEi PS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 20 hits.
PS50017. DEATH_DOMAIN. 1 hit.
PS51145. ZU5. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Murine erythrocyte ankyrin cDNA: highly conserved regions of the regulatory domain."
    White R.A., Birkenmeier C.S., Peters L.L., Barker J.E., Lux S.E.
    Mamm. Genome 3:281-285(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ER1).
    Tissue: Erythrocyte.
  2. "Complex patterns of sequence variation and multiple 5' and 3' ends are found among transcripts of the erythroid ankyrin gene."
    Birkenmeier C.S., White R.A., Peters L.L., Hall E.J., Lux S.E., Barker J.E.
    J. Biol. Chem. 268:9533-9540(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BR2; ER3 AND BR4).
    Strain: C57BL/6J.
    Tissue: Cerebellum.
  3. "An alternative first exon in the distal end of the erythroid ankyrin gene leads to production of a small isoform containing an NH2-terminal membrane anchor."
    Birkenmeier C.S., Sharp J.J., Gifford E.J., Deveau S.A., Barker J.E.
    Genomics 50:79-88(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM MU7), TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
    Strain: C57BL/6J.
    Tissue: Skeletal muscle.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS BR2; 5; 6 AND MU8).
    Strain: C57BL/6J.
    Tissue: Forelimb and Inner ear.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MU7).
    Tissue: Heart and Lung.
  6. Birkenmeier C.B., Sharp J.J., Hall E.J., Deveau S.A., Barker J.E.
    Submitted (OCT-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Strain: C57BL/6J.
  7. "Asparagine and aspartate hydroxylation of the cytoskeletal ankyrin family is catalyzed by factor-inhibiting hypoxia-inducible factor."
    Yang M., Ge W., Chowdhury R., Claridge T.D., Kramer H.B., Schmierer B., McDonough M.A., Gong L., Kessler B.M., Ratcliffe P.J., Coleman M.L., Schofield C.J.
    J. Biol. Chem. 286:7648-7660(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 95-106, HYDROXYLATION AT ASN-101.
  8. "Small, membrane-bound, alternatively spliced forms of ankyrin 1 associated with the sarcoplasmic reticulum of mammalian skeletal muscle."
    Zhou D., Birkenmeier C.S., Williams M.W., Sharp J.J., Barker J.E., Bloch R.J.
    J. Cell Biol. 136:621-631(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  9. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
    Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
    Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-852 AND THR-862, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-957 AND SER-1388, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  11. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
    Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
    J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-1069, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.

Entry informationi

Entry nameiANK1_MOUSE
AccessioniPrimary (citable) accession number: Q02357
Secondary accession number(s): P70440
, P97446, P97941, Q3TZ35, Q3UH42, Q3UHP2, Q3UYY7, Q61302, Q61303, Q78E45
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: May 16, 2006
Last modified: July 9, 2014
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi