Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tumor necrosis factor receptor superfamily member 17

Gene

TNFRSF17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.3 Publications

GO - Molecular functioni

  • receptor activity Source: ProtInc

GO - Biological processi

  • adaptive immune response Source: UniProtKB-KW
  • cell proliferation Source: ProtInc
  • lymphocyte homeostasis Source: Ensembl
  • multicellular organism development Source: ProtInc
  • signal transduction Source: ProtInc
  • tumor necrosis factor-mediated signaling pathway Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Adaptive immunity, Immunity

Enzyme and pathway databases

BioCyciZFISH:ENSG00000048462-MONOMER.
ReactomeiR-HSA-5669034. TNFs bind their physiological receptors.
SIGNORiQ02223.

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 17
Alternative name(s):
B-cell maturation protein
CD_antigen: CD269
Gene namesi
Name:TNFRSF17
Synonyms:BCM, BCMA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:11913. TNFRSF17.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 54ExtracellularSequence analysisAdd BLAST54
Transmembranei55 – 77Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST23
Topological domaini78 – 184CytoplasmicSequence analysisAdd BLAST107

GO - Cellular componenti

  • endomembrane system Source: UniProtKB-SubCell
  • integral component of membrane Source: ProtInc
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei3 – 4Breakpoint for translocation to form IL2/TNFRSF17 oncogene2

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNETi608.
OpenTargetsiENSG00000048462.
PharmGKBiPA36606.

Polymorphism and mutation databases

BioMutaiTNFRSF17.
DMDMi313104029.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000589351 – 184Tumor necrosis factor receptor superfamily member 17Add BLAST184

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi8 ↔ 212 Publications
Disulfide bondi24 ↔ 372 Publications
Disulfide bondi28 ↔ 412 Publications

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ02223.
PeptideAtlasiQ02223.
PRIDEiQ02223.

PTM databases

iPTMnetiQ02223.
PhosphoSitePlusiQ02223.

Expressioni

Tissue specificityi

Expressed in mature B-cells, but not in T-cells or monocytes.

Gene expression databases

BgeeiENSG00000048462.
CleanExiHS_TNFRSF17.
ExpressionAtlasiQ02223. baseline and differential.
GenevisibleiQ02223. HS.

Interactioni

Subunit structurei

Associates with TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6.2 Publications

Protein-protein interaction databases

BioGridi107080. 16 interactors.
IntActiQ02223. 4 interactors.
STRINGi9606.ENSP00000053243.

Structurei

Secondary structure

1184
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi12 – 15Combined sources4
Turni16 – 19Combined sources4
Beta strandi20 – 23Combined sources4
Helixi24 – 27Combined sources4
Beta strandi30 – 32Combined sources3
Helixi35 – 37Combined sources3
Turni38 – 40Combined sources3
Turni42 – 44Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OQDX-ray2.60K/L/M/N/O/P/Q/R8-46[»]
1XU2X-ray2.35R/S/T5-51[»]
2KN1NMR-A2-50[»]
4ZFOX-ray1.90F/K1-54[»]
ProteinModelPortaliQ02223.
SMRiQ02223.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ02223.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati7 – 41TNFR-CysAdd BLAST35

Sequence similaritiesi

Contains 1 TNFR-Cys repeat.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IW7R. Eukaryota.
ENOG4111D91. LUCA.
GeneTreeiENSGT00390000011914.
HOGENOMiHOG000129926.
HOVERGENiHBG062796.
InParanoidiQ02223.
KOiK05153.
OMAiFPLPAME.
OrthoDBiEOG091G0S5G.
PhylomeDBiQ02223.
TreeFamiTF337842.

Family and domain databases

CDDicd13414. TNFRSF17. 1 hit.
InterProiIPR015337. BCMA_Tall-1-bd.
IPR022320. TNFR_17.
[Graphical view]
PfamiPF09257. BCMA-Tall_bind. 1 hit.
[Graphical view]
PIRSFiPIRSF011859. BCMA_Tall-1_bd. 1 hit.
PRINTSiPR01967. TNFACTORR17.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q02223-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLQMAGQCSQ NEYFDSLLHA CIPCQLRCSS NTPPLTCQRY CNASVTNSVK
60 70 80 90 100
GTNAILWTCL GLSLIISLAV FVLMFLLRKI NSEPLKDEFK NTGSGLLGMA
110 120 130 140 150
NIDLEKSRTG DEIILPRGLE YTVEECTCED CIKSKPKVDS DHCFPLPAME
160 170 180
EGATILVTTK TNDYCKSLPA ALSATEIEKS ISAR
Length:184
Mass (Da):20,165
Last modified:November 30, 2010 - v2
Checksum:iB6D87B3685F66022
GO
Isoform 2 (identifier: Q02223-2) [UniParc]FASTAAdd to basket
Also known as: TV4

The sequence of this isoform differs from the canonical sequence as follows:
     44-93: SVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTG → R

Note: Observed only in some CD19+ cell.
Show »
Length:135
Mass (Da):14,843
Checksum:iFC3D1DDBB1195989
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01875554A → V.1 PublicationCorresponds to variant rs11570146dbSNPEnsembl.1
Natural variantiVAR_01875665I → V.1 PublicationCorresponds to variant rs11570147dbSNPEnsembl.1
Natural variantiVAR_01875775F → V.1 PublicationCorresponds to variant rs11570148dbSNPEnsembl.1
Natural variantiVAR_01875881N → S.5 PublicationsCorresponds to variant rs373496dbSNPEnsembl.1
Natural variantiVAR_012234153A → T.1 PublicationCorresponds to variant rs150352299dbSNPEnsembl.1
Natural variantiVAR_018759165C → S.1 PublicationCorresponds to variant rs11570159dbSNPEnsembl.1
Natural variantiVAR_061855176E → D.Corresponds to variant rs34546237dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04767844 – 93SVTNS…FKNTG → R in isoform 2. 2 PublicationsAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z14954 mRNA. Translation: CAA78679.1.
Z29574 Genomic DNA. Translation: CAA82690.1.
Z29575 mRNA. Translation: CAA82691.1.
AB052772 Genomic DNA. Translation: BAB60895.1.
EF152355 mRNA. Translation: ABN42510.1.
AY684975 mRNA. Translation: AAV92616.1.
AY509112 Genomic DNA. Translation: AAR84240.1.
U95742 Genomic DNA. Translation: AAB67251.1.
AC007216 Genomic DNA. No translation available.
CCDSiCCDS10552.1. [Q02223-1]
PIRiS43486.
RefSeqiNP_001183.2. NM_001192.2. [Q02223-1]
UniGeneiHs.2556.

Genome annotation databases

EnsembliENST00000053243; ENSP00000053243; ENSG00000048462. [Q02223-1]
ENST00000396495; ENSP00000379753; ENSG00000048462. [Q02223-2]
GeneIDi608.
KEGGihsa:608.
UCSCiuc002dbv.3. human. [Q02223-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z14954 mRNA. Translation: CAA78679.1.
Z29574 Genomic DNA. Translation: CAA82690.1.
Z29575 mRNA. Translation: CAA82691.1.
AB052772 Genomic DNA. Translation: BAB60895.1.
EF152355 mRNA. Translation: ABN42510.1.
AY684975 mRNA. Translation: AAV92616.1.
AY509112 Genomic DNA. Translation: AAR84240.1.
U95742 Genomic DNA. Translation: AAB67251.1.
AC007216 Genomic DNA. No translation available.
CCDSiCCDS10552.1. [Q02223-1]
PIRiS43486.
RefSeqiNP_001183.2. NM_001192.2. [Q02223-1]
UniGeneiHs.2556.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OQDX-ray2.60K/L/M/N/O/P/Q/R8-46[»]
1XU2X-ray2.35R/S/T5-51[»]
2KN1NMR-A2-50[»]
4ZFOX-ray1.90F/K1-54[»]
ProteinModelPortaliQ02223.
SMRiQ02223.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107080. 16 interactors.
IntActiQ02223. 4 interactors.
STRINGi9606.ENSP00000053243.

PTM databases

iPTMnetiQ02223.
PhosphoSitePlusiQ02223.

Polymorphism and mutation databases

BioMutaiTNFRSF17.
DMDMi313104029.

Proteomic databases

PaxDbiQ02223.
PeptideAtlasiQ02223.
PRIDEiQ02223.

Protocols and materials databases

DNASUi608.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000053243; ENSP00000053243; ENSG00000048462. [Q02223-1]
ENST00000396495; ENSP00000379753; ENSG00000048462. [Q02223-2]
GeneIDi608.
KEGGihsa:608.
UCSCiuc002dbv.3. human. [Q02223-1]

Organism-specific databases

CTDi608.
DisGeNETi608.
GeneCardsiTNFRSF17.
HGNCiHGNC:11913. TNFRSF17.
MIMi109545. gene.
neXtProtiNX_Q02223.
OpenTargetsiENSG00000048462.
PharmGKBiPA36606.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IW7R. Eukaryota.
ENOG4111D91. LUCA.
GeneTreeiENSGT00390000011914.
HOGENOMiHOG000129926.
HOVERGENiHBG062796.
InParanoidiQ02223.
KOiK05153.
OMAiFPLPAME.
OrthoDBiEOG091G0S5G.
PhylomeDBiQ02223.
TreeFamiTF337842.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000048462-MONOMER.
ReactomeiR-HSA-5669034. TNFs bind their physiological receptors.
SIGNORiQ02223.

Miscellaneous databases

ChiTaRSiTNFRSF17. human.
EvolutionaryTraceiQ02223.
GeneWikiiTNFRSF17.
GenomeRNAii608.
PROiQ02223.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000048462.
CleanExiHS_TNFRSF17.
ExpressionAtlasiQ02223. baseline and differential.
GenevisibleiQ02223. HS.

Family and domain databases

CDDicd13414. TNFRSF17. 1 hit.
InterProiIPR015337. BCMA_Tall-1-bd.
IPR022320. TNFR_17.
[Graphical view]
PfamiPF09257. BCMA-Tall_bind. 1 hit.
[Graphical view]
PIRSFiPIRSF011859. BCMA_Tall-1_bd. 1 hit.
PRINTSiPR01967. TNFACTORR17.
ProtoNetiSearch...

Entry informationi

Entry nameiTNR17_HUMAN
AccessioniPrimary (citable) accession number: Q02223
Secondary accession number(s): Q2TQ40
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: November 30, 2010
Last modified: November 2, 2016
This is version 169 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.