SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q02223

- TNR17_HUMAN

UniProt

Q02223 - TNR17_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Tumor necrosis factor receptor superfamily member 17
Gene
TNFRSF17, BCM, BCMA
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.3 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei3 – 42Breakpoint for translocation to form IL2/TNFRSF17 oncogene

GO - Molecular functioni

  1. receptor activity Source: ProtInc

GO - Biological processi

  1. cell proliferation Source: ProtInc
  2. immune system process Source: UniProtKB-KW
  3. multicellular organismal development Source: ProtInc
  4. signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Adaptive immunity, Immunity

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 17
Alternative name(s):
B-cell maturation protein
CD_antigen: CD269
Gene namesi
Synonyms:BCM, BCMA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:11913. TNFRSF17.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 5454Extracellular Reviewed prediction
Add
BLAST
Transmembranei55 – 7723Helical; Signal-anchor for type III membrane protein; Reviewed prediction
Add
BLAST
Topological domaini78 – 184107Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. endomembrane system Source: UniProtKB-SubCell
  2. integral component of membrane Source: ProtInc
  3. plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

PharmGKBiPA36606.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 184184Tumor necrosis factor receptor superfamily member 17
PRO_0000058935Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi8 ↔ 212 Publications
Disulfide bondi24 ↔ 372 Publications
Disulfide bondi28 ↔ 412 Publications

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ02223.
PRIDEiQ02223.

PTM databases

PhosphoSiteiQ02223.

Expressioni

Tissue specificityi

Expressed in mature B-cells, but not in T-cells or monocytes.

Gene expression databases

ArrayExpressiQ02223.
BgeeiQ02223.
CleanExiHS_TNFRSF17.
GenevestigatoriQ02223.

Organism-specific databases

HPAiHPA010569.

Interactioni

Subunit structurei

Associates with TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6.

Protein-protein interaction databases

BioGridi107080. 7 interactions.
IntActiQ02223. 4 interactions.
STRINGi9606.ENSP00000053243.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi12 – 154
Turni16 – 194
Beta strandi20 – 234
Helixi24 – 263
Turni27 – 293
Beta strandi30 – 323
Helixi35 – 373
Helixi38 – 425

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1OQDX-ray2.60K/L/M/N/O/P/Q/R8-46[»]
1XU2X-ray2.35R/S/T5-51[»]
2KN1NMR-A2-50[»]
ProteinModelPortaliQ02223.
SMRiQ02223. Positions 8-46.

Miscellaneous databases

EvolutionaryTraceiQ02223.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati7 – 4135TNFR-Cys
Add
BLAST

Sequence similaritiesi

Contains 1 TNFR-Cys repeat.

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG46220.
HOGENOMiHOG000129926.
HOVERGENiHBG062796.
InParanoidiQ02223.
KOiK05153.
OMAiTKTNDYC.
OrthoDBiEOG7Z95NN.
PhylomeDBiQ02223.
TreeFamiTF337842.

Family and domain databases

InterProiIPR015337. BCMA_Tall-1-bd.
IPR022320. TNFR_17.
[Graphical view]
PfamiPF09257. BCMA-Tall_bind. 1 hit.
[Graphical view]
PIRSFiPIRSF011859. BCMA_Tall-1_bd. 1 hit.
PRINTSiPR01967. TNFACTORR17.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q02223-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLQMAGQCSQ NEYFDSLLHA CIPCQLRCSS NTPPLTCQRY CNASVTNSVK    50
GTNAILWTCL GLSLIISLAV FVLMFLLRKI NSEPLKDEFK NTGSGLLGMA 100
NIDLEKSRTG DEIILPRGLE YTVEECTCED CIKSKPKVDS DHCFPLPAME 150
EGATILVTTK TNDYCKSLPA ALSATEIEKS ISAR 184
Length:184
Mass (Da):20,165
Last modified:November 30, 2010 - v2
Checksum:iB6D87B3685F66022
GO
Isoform 2 (identifier: Q02223-2) [UniParc]FASTAAdd to Basket

Also known as: TV4

The sequence of this isoform differs from the canonical sequence as follows:
     44-93: SVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTG → R

Note: Observed only in some CD19+ cell samples.

Show »
Length:135
Mass (Da):14,843
Checksum:iFC3D1DDBB1195989
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti54 – 541A → V.1 Publication
Corresponds to variant rs11570146 [ dbSNP | Ensembl ].
VAR_018755
Natural varianti65 – 651I → V.1 Publication
Corresponds to variant rs11570147 [ dbSNP | Ensembl ].
VAR_018756
Natural varianti75 – 751F → V.1 Publication
Corresponds to variant rs11570148 [ dbSNP | Ensembl ].
VAR_018757
Natural varianti81 – 811N → S.5 Publications
Corresponds to variant rs373496 [ dbSNP | Ensembl ].
VAR_018758
Natural varianti153 – 1531A → T.1 Publication
Corresponds to variant rs150352299 [ dbSNP | Ensembl ].
VAR_012234
Natural varianti165 – 1651C → S.1 Publication
Corresponds to variant rs11570159 [ dbSNP | Ensembl ].
VAR_018759
Natural varianti176 – 1761E → D.
Corresponds to variant rs34546237 [ dbSNP | Ensembl ].
VAR_061855

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei44 – 9350SVTNS…FKNTG → R in isoform 2.
VSP_047678Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z14954 mRNA. Translation: CAA78679.1.
Z29574 Genomic DNA. Translation: CAA82690.1.
Z29575 mRNA. Translation: CAA82691.1.
AB052772 Genomic DNA. Translation: BAB60895.1.
EF152355 mRNA. Translation: ABN42510.1.
AY684975 mRNA. Translation: AAV92616.1.
AY509112 Genomic DNA. Translation: AAR84240.1.
U95742 Genomic DNA. Translation: AAB67251.1.
AC007216 Genomic DNA. No translation available.
CCDSiCCDS10552.1. [Q02223-1]
PIRiS43486.
RefSeqiNP_001183.2. NM_001192.2. [Q02223-1]
UniGeneiHs.2556.

Genome annotation databases

EnsembliENST00000053243; ENSP00000053243; ENSG00000048462. [Q02223-1]
ENST00000396495; ENSP00000379753; ENSG00000048462. [Q02223-2]
GeneIDi608.
KEGGihsa:608.
UCSCiuc002dbv.3. human. [Q02223-1]

Polymorphism databases

DMDMi313104029.

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z14954 mRNA. Translation: CAA78679.1 .
Z29574 Genomic DNA. Translation: CAA82690.1 .
Z29575 mRNA. Translation: CAA82691.1 .
AB052772 Genomic DNA. Translation: BAB60895.1 .
EF152355 mRNA. Translation: ABN42510.1 .
AY684975 mRNA. Translation: AAV92616.1 .
AY509112 Genomic DNA. Translation: AAR84240.1 .
U95742 Genomic DNA. Translation: AAB67251.1 .
AC007216 Genomic DNA. No translation available.
CCDSi CCDS10552.1. [Q02223-1 ]
PIRi S43486.
RefSeqi NP_001183.2. NM_001192.2. [Q02223-1 ]
UniGenei Hs.2556.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1OQD X-ray 2.60 K/L/M/N/O/P/Q/R 8-46 [» ]
1XU2 X-ray 2.35 R/S/T 5-51 [» ]
2KN1 NMR - A 2-50 [» ]
ProteinModelPortali Q02223.
SMRi Q02223. Positions 8-46.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107080. 7 interactions.
IntActi Q02223. 4 interactions.
STRINGi 9606.ENSP00000053243.

Chemistry

GuidetoPHARMACOLOGYi 1889.

PTM databases

PhosphoSitei Q02223.

Polymorphism databases

DMDMi 313104029.

Proteomic databases

PaxDbi Q02223.
PRIDEi Q02223.

Protocols and materials databases

DNASUi 608.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000053243 ; ENSP00000053243 ; ENSG00000048462 . [Q02223-1 ]
ENST00000396495 ; ENSP00000379753 ; ENSG00000048462 . [Q02223-2 ]
GeneIDi 608.
KEGGi hsa:608.
UCSCi uc002dbv.3. human. [Q02223-1 ]

Organism-specific databases

CTDi 608.
GeneCardsi GC16P012058.
HGNCi HGNC:11913. TNFRSF17.
HPAi HPA010569.
MIMi 109545. gene.
neXtProti NX_Q02223.
PharmGKBi PA36606.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG46220.
HOGENOMi HOG000129926.
HOVERGENi HBG062796.
InParanoidi Q02223.
KOi K05153.
OMAi TKTNDYC.
OrthoDBi EOG7Z95NN.
PhylomeDBi Q02223.
TreeFami TF337842.

Miscellaneous databases

ChiTaRSi TNFRSF17. human.
EvolutionaryTracei Q02223.
GeneWikii TNFRSF17.
GenomeRNAii 608.
NextBioi 2473.
PROi Q02223.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q02223.
Bgeei Q02223.
CleanExi HS_TNFRSF17.
Genevestigatori Q02223.

Family and domain databases

InterProi IPR015337. BCMA_Tall-1-bd.
IPR022320. TNFR_17.
[Graphical view ]
Pfami PF09257. BCMA-Tall_bind. 1 hit.
[Graphical view ]
PIRSFi PIRSF011859. BCMA_Tall-1_bd. 1 hit.
PRINTSi PR01967. TNFACTORR17.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A new gene, BCM, on chromosome 16 is fused to the interleukin 2 gene by a t(4;16)(q26;p13) translocation in a malignant T cell lymphoma."
    Laabi Y., Gras M.P., Carbonnel F., Brouet J.C., Berger R., Larsen C.-J., Tsapis A.
    EMBO J. 11:3897-3904(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHROMOSOMAL TRANSLOCATION, VARIANT SER-81.
    Tissue: Lymph node and Peripheral blood leukocyte.
  2. "The BCMA gene, preferentially expressed during B lymphoid maturation, is bidirectionally transcribed."
    Laabi Y., Gras M.P., Brouet J.C., Berger R., Larsen C.J., Tsapis A.
    Nucleic Acids Res. 22:1147-1154(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), VARIANT SER-81.
  3. "Presence of four major haplotypes in human BCMA gene: lack of association with systemic lupus erythematosus and rheumatoid arthritis."
    Kawasaki A., Tsuchiya N., Fukazawa T., Hashimoto H., Tokunaga K.
    Genes Immun. 2:276-279(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS SER-81 AND THR-153.
  4. "Identification of new splice variants of the genes BAFF and BCMA."
    Smirnova A.S., Andrade-Oliveira V., Gerbase-DeLima M.
    Mol. Immunol. 45:1179-1183(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Peripheral blood.
  5. "Novel, secreted isoform of human tumor necrosis factor receptor superfamily, member 17 (TNFRSF17)."
    Maia S., Freeman G.J., Nadler L.M., Cardoso A.A.
    Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  6. NIEHS SNPs program
    Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS VAL-54; VAL-65; VAL-75; SER-81 AND SER-165.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT SER-81.
  8. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "TNF receptor family member BCMA (B cell maturation) associates with TNF receptor-associated factor (TRAF) 1, TRAF2, and TRAF3 and activates NF-kappa B, elk-1, c-Jun N-terminal kinase, and p38 mitogen-activated protein kinase."
    Hatzoglou A., Roussel J., Bourgeade M.-F., Rogier E., Madry C., Inoue J., Devergne O., Tsapis A.
    J. Immunol. 165:1322-1330(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH TRAF1 AND TRAF3.
  10. Cited for: FUNCTION.
  11. Cited for: FUNCTION, INTERACTION WITH APRIL AND BAFF.
  12. "B cell maturation protein is a receptor for the tumor necrosis factor family member TALL-1."
    Shu H.-B., Johnson H.
    Proc. Natl. Acad. Sci. U.S.A. 97:9156-9161(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TRAF5 AND TRAF6.
  13. "Ligand-receptor binding revealed by the TNF family member TALL-1."
    Liu Y., Hong X., Kappler J., Jiang L., Zhang R., Xu L., Pan C.-H., Martin W.E., Murphy R.C., Shu H.-B., Dai S., Zhang G.
    Nature 423:49-56(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 8-46 IN COMPLEX WITH TNFSF13B, DISULFIDE BONDS.
  14. "Structures of APRIL-receptor complexes: like BCMA, TACI employs only a single cysteine-rich domain for high affinity ligand binding."
    Hymowitz S.G., Patel D.R., Wallweber H.J., Runyon S., Yan M., Yin J., Shriver S.K., Gordon N.C., Pan B., Skelton N.J., Kelley R.F., Starovasnik M.A.
    J. Biol. Chem. 280:7218-7227(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.35 ANGSTROMS) OF 5-51 IN COMPLEX WITH MOUSE TNFSF13B, DISULFIDE BONDS.

Entry informationi

Entry nameiTNR17_HUMAN
AccessioniPrimary (citable) accession number: Q02223
Secondary accession number(s): Q2TQ40
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: November 30, 2010
Last modified: July 9, 2014
This is version 150 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi