Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q02094 (RHAG_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 124. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ammonium transporter Rh type A
Alternative name(s):
Erythrocyte membrane glycoprotein Rh50
Erythrocyte plasma membrane 50 kDa glycoprotein
Short name=Rh50A
Rhesus blood group family type A glycoprotein
Short name=Rh family type A glycoprotein
Short name=Rh type A glycoprotein
Rhesus blood group-associated ammonia channel
Rhesus blood group-associated glycoprotein
CD_antigen=CD241
Gene names
Name:RHAG
Synonyms:RH50
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length409 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Associated with rhesus blood group antigen expression. May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. Ref.8 Ref.9

Subunit structure

Heterotetramer.

Subcellular location

Membrane; Multi-pass membrane protein.

Tissue specificity

Erythrocytes. Ref.6

Involvement in disease

Regulator type Rh-null hemolytic anemia (RHN) [MIM:268150]: Form of chronic hemolytic anemia in which the red blood cells have a stomatocytosis and spherocytosis morphology, an increased osmotic fragility, an altered ion transport system, and abnormal membrane phospholipid organization.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.11 Ref.12 Ref.13 Ref.14

Sequence similarities

Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily. [View classification]

Ontologies

Keywords
   Biological processAmmonia transport
Transport
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DiseaseDisease mutation
   DomainTransmembrane
Transmembrane helix
   PTMGlycoprotein
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processammonium transmembrane transport

Inferred from direct assay PubMed 15856280PubMed 15929723PubMed 16866382PubMed 17712059PubMed 19273840. Source: GOC

ammonium transport

Inferred from direct assay PubMed 15856280PubMed 15929723PubMed 16574458PubMed 16866382PubMed 17712059PubMed 19273840. Source: UniProtKB

bicarbonate transport

Traceable author statement. Source: Reactome

carbon dioxide transport

Inferred from direct assay PubMed 16574458PubMed 17712059PubMed 19273840. Source: UniProtKB

cellular ion homeostasis

Inferred from direct assay PubMed 15856280. Source: UniProtKB

small molecule metabolic process

Traceable author statement. Source: Reactome

transmembrane transport

Traceable author statement. Source: Reactome

   Cellular_componentintegral component of plasma membrane

Traceable author statement Ref.1. Source: ProtInc

plasma membrane

Inferred from direct assay PubMed 15929723. Source: UniProtKB

   Molecular_functionammonium transmembrane transporter activity

Inferred from direct assay PubMed 15856280PubMed 15929723PubMed 16866382PubMed 17712059PubMed 19273840. Source: UniProtKB

ankyrin binding

Inferred from physical interaction PubMed 12719424PubMed 16580865. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q02094-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q02094-2)

The sequence of this isoform differs from the canonical sequence as follows:
     316-351: PLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVAM → VYGHAGSCTGFLYRNSSCWRSDDRFNSKVASLGTAI
     352-409: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 409409Ammonium transporter Rh type A
PRO_0000168199

Regions

Topological domain1 – 22Cytoplasmic Potential
Transmembrane3 – 2321Helical; Potential
Topological domain24 – 5128Extracellular Potential
Transmembrane52 – 7221Helical; Potential
Topological domain73 – 797Cytoplasmic Potential
Transmembrane80 – 10021Helical; Potential
Topological domain101 – 11313Extracellular Potential
Transmembrane114 – 13421Helical; Potential
Topological domain135 – 1428Cytoplasmic Potential
Transmembrane143 – 16321Helical; Potential
Topological domain164 – 1674Extracellular Potential
Transmembrane168 – 18821Helical; Potential
Topological domain189 – 20820Cytoplasmic Potential
Transmembrane209 – 22921Helical; Potential
Topological domain230 – 23910Extracellular Potential
Transmembrane240 – 26021Helical; Potential
Topological domain261 – 2688Cytoplasmic Potential
Transmembrane269 – 29123Helical; Potential
Topological domain292 – 2954Extracellular Potential
Transmembrane296 – 31823Helical; Potential
Topological domain319 – 33214Cytoplasmic Potential
Transmembrane333 – 35321Helical; Potential
Topological domain354 – 3629Extracellular Potential
Transmembrane363 – 38321Helical; Potential
Topological domain384 – 40926Cytoplasmic Potential

Amino acid modifications

Glycosylation371N-linked (GlcNAc...) Potential
Glycosylation3551N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence316 – 35136PLFTT…VAVAM → VYGHAGSCTGFLYRNSSCWR SDDRFNSKVASLGTAI in isoform 2.
VSP_047629
Alternative sequence352 – 40958Missing in isoform 2.
VSP_047630
Natural variant791S → N in RHN. Ref.11
VAR_006921
Natural variant2421N → D. Ref.1
Corresponds to variant rs1058063 [ dbSNP | Ensembl ].
VAR_047999
Natural variant2701V → I in RHN. Ref.3 Ref.14
Corresponds to variant rs16879498 [ dbSNP | Ensembl ].
VAR_015855
Natural variant2791G → E in RHN. Ref.12 Ref.13
Corresponds to variant rs28933991 [ dbSNP | Ensembl ].
VAR_015856
Natural variant2801G → R in RHN. Ref.14
VAR_015857
Natural variant3801G → V in RHN. Ref.14
VAR_015858

Experimental info

Sequence conflict21R → C AA sequence Ref.7
Sequence conflict371N → P AA sequence Ref.7

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 16, 2008. Version 2.
Checksum: F6F024399CC0C88D

FASTA40944,198
        10         20         30         40         50         60 
MRFTFPLMAI VLEIAMIVLF GLFVEYETDQ TVLEQLNITK PTDMGIFFEL YPLFQDVHVM 

        70         80         90        100        110        120 
IFVGFGFLMT FLKKYGFSSV GINLLVAALG LQWGTIVQGI LQSQGQKFNI GIKNMINADF 

       130        140        150        160        170        180 
SAATVLISFG AVLGKTSPTQ MLIMTILEIV FFAHNEYLVS EIFKASDIGA SMTIHAFGAY 

       190        200        210        220        230        240 
FGLAVAGILY RSGLRKGHEN EESAYYSDLF AMIGTLFLWM FWPSFNSAIA EPGDKQCRAI 

       250        260        270        280        290        300 
VNTYFSLAAC VLTAFAFSSL VEHRGKLNMV HIQNATLAGG VAVGTCADMA IHPFGSMIIG 

       310        320        330        340        350        360 
SIAGMVSVLG YKFLTPLFTT KLRIHDTCGV HNLHGLPGVV GGLAGIVAVA MGASNTSMAM 

       370        380        390        400 
QAAALGSSIG TAVVGGLMTG LILKLPLWGQ PSDQNCYDDS VYWKVPKTR 

« Hide

Isoform 2 [UniParc].

Checksum: 1BEF505C51B6F060
Show »

FASTA35138,420

References

« Hide 'large scale' references
[1]"Isolation of cDNA clones for a 50 kDa glycoprotein of the human erythrocyte membrane associated with Rh (rhesus) blood-group antigen expression."
Ridgwell K., Spurr N.K., Laguda B., Macgeoch C., Avent N.D., Tanner M.J.A.
Biochem. J. 287:223-228(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ASP-242.
Tissue: Bone marrow and Liver.
[2]"The human Rh50 glycoprotein gene. Structural organization and associated splicing defect resulting in Rh(null) disease."
Huang C.-H.
J. Biol. Chem. 273:2207-2213(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ILE-270.
Tissue: Heart.
[4]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"Identification of 5' flanking sequence of RH50 gene and the core region for erythroid-specific expression."
Iwamoto S., Omi T., Yamasaki M., Okuda H., Kawano M., Kajii E.
Biochem. Biophys. Res. Commun. 243:233-240(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-52, TISSUE SPECIFICITY.
[7]"Protein-sequence studies on Rh-related polypeptides suggest the presence of at least two groups of proteins which associate in the human red-cell membrane."
Avent N.D., Ridgwell K., Mawby W.J., Tanner M.J.A., Anstee D.J., Kumpel B.
Biochem. J. 256:1043-1046(1988) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 1-39.
[8]"The human Rhesus-associated RhAG protein and a kidney homologue promote ammonium transport in yeast."
Marini A.-M., Matassi G., Raynal V., Andre B., Cartron J.-P., Cherif-Zahar B.
Nat. Genet. 26:341-344(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[9]"Identification of the erythrocyte Rh blood group glycoprotein as a mammalian ammonium transporter."
Westhoff C.M., Ferreri-Jacobia M., Mak D.-O.D., Foskett J.K.
J. Biol. Chem. 277:12499-12502(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[10]"Mechanism of genetic complementation of ammonium transport in yeast by human erythrocyte Rh-associated glycoprotein."
Westhoff C.M., Siegel D.L., Burd C.G., Foskett J.K.
J. Biol. Chem. 279:17443-17448(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: CHARACTERIZATION.
[11]"Candidate gene acting as a suppressor of the RH locus in most cases of Rh-deficiency."
Cherif-Zahar B., Raynal V., Gane P., Mattei M.-G., Bailly P., Gibbs B., Colin Y., Cartron J.-P.
Nat. Genet. 12:168-173(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT RHN ASN-79.
[12]"A novel single missense mutation identified along the RH50 gene in a composite heterozygous Rhnull blood donor of the regulator type."
Hyland C.A., Cherif-Zahar B., Cowley N., Raynal V., Parkes J., Saul A., Cartron J.-P.
Blood 91:1458-1463(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT RHN GLU-279.
[13]"Rh50 glycoprotein gene and rhnull disease: a silent splice donor is trans to a Gly279-->Glu missense mutation in the conserved transmembrane segment."
Huang C.-H., Liu Z., Cheng G., Chen Y.
Blood 92:1776-1784(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT RHN GLU-279.
[14]"Molecular basis for Rh(null) syndrome: identification of three new missense mutations in the Rh50 glycoprotein gene."
Huang C.-H., Cheng G., Liu Z., Chen Y., Reid M.E., Halverson G., Okubo Y.
Am. J. Hematol. 62:25-32(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS RHN ILE-270; ARG-280 AND VAL-380.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X64594 mRNA. Translation: CAA45883.1.
AF031548 mRNA. Translation: AAC04247.1.
AF031549 mRNA. Translation: AAC04248.1.
AF237387 expand/collapse EMBL AC list , AF237382, AF237383, AF237384, AF237385, AF237386 Genomic DNA. Translation: AAF78209.1.
AK313505 mRNA. Translation: BAG36285.1.
AL121950, AL590244 Genomic DNA. Translation: CAC10519.2.
AL590244, AL121950 Genomic DNA. Translation: CAI13085.1.
CH471081 Genomic DNA. Translation: EAX04337.1.
CH471081 Genomic DNA. Translation: EAX04338.1.
CCDSCCDS4927.1. [Q02094-1]
PIRS29124.
RefSeqNP_000315.2. NM_000324.2. [Q02094-1]
UniGeneHs.120950.

3D structure databases

ProteinModelPortalQ02094.
SMRQ02094. Positions 1-407.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid111937. 1 interaction.
STRING9606.ENSP00000360217.

Chemistry

GuidetoPHARMACOLOGY1198.

Protein family/group databases

TCDB1.A.11.4.3. the ammonia transporter channel (amt) family.

PTM databases

PhosphoSiteQ02094.

Polymorphism databases

DMDM218511807.

Proteomic databases

PaxDbQ02094.
PRIDEQ02094.

Protocols and materials databases

DNASU6005.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000229810; ENSP00000229810; ENSG00000112077. [Q02094-2]
ENST00000371175; ENSP00000360217; ENSG00000112077. [Q02094-1]
GeneID6005.
KEGGhsa:6005.
UCSCuc003ozk.4. human. [Q02094-1]

Organism-specific databases

CTD6005.
GeneCardsGC06M049619.
H-InvDBHIX0005947.
HGNCHGNC:10006. RHAG.
HPAHPA055331.
MIM180297. gene.
268150. phenotype.
neXtProtNX_Q02094.
Orphanet3203. Overhydrated hereditary stomatocytosis.
71275. Rh deficiency syndrome.
PharmGKBPA34381.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG276393.
HOGENOMHOG000007656.
HOVERGENHBG004374.
InParanoidQ02094.
KOK06580.
OMANEESAYY.
OrthoDBEOG73NG3C.
PhylomeDBQ02094.
TreeFamTF314450.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.
REACT_15518. Transmembrane transport of small molecules.
REACT_20679. Amine compound SLC transporters.

Gene expression databases

ArrayExpressQ02094.
BgeeQ02094.
CleanExHS_RHAG.
GenevestigatorQ02094.

Family and domain databases

Gene3D1.10.3430.10. 1 hit.
InterProIPR029020. Ammonium/urea_transptr.
IPR024041. NH4_transpt_AmtB-like_dom.
IPR002229. RhesusRHD.
[Graphical view]
PfamPF00909. Ammonium_transp. 1 hit.
[Graphical view]
PRINTSPR00342. RHESUSRHD.
SUPFAMSSF111352. SSF111352. 1 hit.
ProtoNetSearch...

Other

GeneWikiRHAG.
GenomeRNAi6005.
NextBio23423.
PROQ02094.
SOURCESearch...

Entry information

Entry nameRHAG_HUMAN
AccessionPrimary (citable) accession number: Q02094
Secondary accession number(s): B2R8T8 expand/collapse secondary AC list , O43514, O43515, Q7L8L3, Q9H454
Entry history
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: December 16, 2008
Last modified: July 9, 2014
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries