Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q02038 (NEUL_PIG) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 96. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Neurolysin, mitochondrial

EC=3.4.24.16
Alternative name(s):
Endopeptidase 24.16
Microsomal endopeptidase
Short name=MEP
Mitochondrial oligopeptidase M
Neurotensin endopeptidase
Soluble angiotensin-binding protein
Short name=SABP
Gene names
Name:NLN
OrganismSus scrofa (Pig) [Reference proteome]
Taxonomic identifier9823 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaSuinaSuidaeSus

Protein attributes

Sequence length704 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Binds angiotensins and its analogs.

Catalytic activity

Preferential cleavage in neurotensin: 10-Pro-|-Tyr-11.

Cofactor

Binds 1 zinc ion per subunit By similarity.

Subcellular location

Isoform 1: Mitochondrion Ref.2.

Isoform 2: Cytoplasm Ref.2.

Isoform 3: Cytoplasm Ref.2.

Isoform 4: Cytoplasm Ref.2.

Isoform 5: Cytoplasm Ref.2.

Tissue specificity

Predominantly expressed in the liver, kidney and adrenal gland. Ref.1

Sequence similarities

Belongs to the peptidase M3 family.

Ontologies

Keywords
   Cellular componentCytoplasm
Mitochondrion
   Coding sequence diversityAlternative splicing
   DomainTransit peptide
   LigandMetal-binding
Zinc
   Molecular functionHydrolase
Metalloprotease
Protease
   PTMAcetylation
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processproteolysis

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentcytosol

Inferred from direct assay Ref.2. Source: UniProtKB

mitochondrion

Inferred from direct assay Ref.2. Source: UniProtKB

   Molecular_functionendopeptidase activity

Traceable author statement Ref.2. Source: UniProtKB

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

metalloendopeptidase activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q02038-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q02038-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MIVRCLSAARRLHR → MVYPEGHLARELGATFSSSAPLGGHPFPFVWDCLSCKQGDWSQARPKTNAERRSG
Isoform 3 (identifier: Q02038-3)

Also known as: 3';

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: Missing.
Isoform 4 (identifier: Q02038-4)

Also known as: 1';

The sequence of this isoform differs from the canonical sequence as follows:
     15-95: VGGSGILLRM...ENCLQALADV → ETPLSKFHIL...FKMGSFTRAN
     96-704: Missing.
Note: Truncated due to inclusion of exon 4 which leads to premature stop codon.
Isoform 5 (identifier: Q02038-5)

Also known as: 2';

The sequence of this isoform differs from the canonical sequence as follows:
     1-136: MIVRCLSAAR...KRLSRFDIEM → MVYPEGHLAR...FKMGSFTRAN
     137-704: Missing.
Note: Truncated due to inclusion of exon 4 which leads to premature stop codon.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Transit peptide1 – 3737Mitochondrion By similarity
Chain38 – 704667Neurolysin, mitochondrial
PRO_0000028576

Sites

Active site4981 By similarity
Metal binding4971Zinc; catalytic By similarity
Metal binding5011Zinc; catalytic By similarity
Metal binding5041Zinc; catalytic By similarity

Amino acid modifications

Modified residue6641N6-acetyllysine By similarity

Natural variations

Alternative sequence1 – 136136MIVRC…FDIEM → MVYPEGHLARELGATFSSSA PLGGHPFPFVWDCLSCKQGD WSQARPKTNAERRSGETPLS KFHILALVPLSILPVPRQKP GCHPESLTSSTHLGWWFRDF IENDFRERSNVSSSGNVFLY CGWQKCFKMGSFTRAN in isoform 5.
VSP_019391
Alternative sequence1 – 2323Missing in isoform 3.
VSP_019390
Alternative sequence1 – 1414MIVRC…RRLHR → MVYPEGHLARELGATFSSSA PLGGHPFPFVWDCLSCKQGD WSQARPKTNAERRSG in isoform 2.
VSP_019392
Alternative sequence15 – 9581VGGSG…ALADV → ETPLSKFHILALVPLSILPV PRQKPGCHPESLTSSTHLGW WFRDFIENDFRERSNVSSSG NVFLYCGWQKCFKMGSFTRA N in isoform 4.
VSP_019393
Alternative sequence96 – 704609Missing in isoform 4.
VSP_019394
Alternative sequence137 – 704568Missing in isoform 5.
VSP_019395

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 1993. Version 1.
Checksum: A02BFEC67B7044A1

FASTA70480,757
        10         20         30         40         50         60 
MIVRCLSAAR RLHRVGGSGI LLRMTLGREA MSPLQAMSSY TVDGRNVLRW DLSPEQIKRR 

        70         80         90        100        110        120 
TEELIAQTKQ VYDDIGMLDI EEVTYENCLQ ALADVEVKYI VERTMLDFPQ HVSSDKEVRA 

       130        140        150        160        170        180 
ASTEADKRLS RFDIEMSMRE DIFLRIVRLK ETCDLGKIKP EARRYLEKSV KMGKRNGLHL 

       190        200        210        220        230        240 
PEQVQNEIKA MKKRMSELCI DFNKNLNEDD TFLVFSKAEL GALPDDFIDS LEKTDDNKYK 

       250        260        270        280        290        300 
ITLKYPHYFP VMKKCCIPET RRKMEMAFNT RCKEENTIIL QELLPLRAKV AKLLGYSTHA 

       310        320        330        340        350        360 
DFVLEMNTAK STHHVTAFLD DLSQKLKPLG EAEREFILNL KKKECEEKGF EYDGKINAWD 

       370        380        390        400        410        420 
LHYYMTQTEE LKYSVDQEIL KEYFPIEVVT EGLLNIYQEL LGLSFEQVTD AHVWNKSVTL 

       430        440        450        460        470        480 
YTVKDKATGE VLGQFYLDLY PREGKYNHAA CFGLQPGCLL PDGSRMMSVA ALVVNFSQPR 

       490        500        510        520        530        540 
AGRPSLLRHD EVRTYFHEFG HVMHQICAQT DFARFSGTNV ETDFVEVPSQ MLENWVWDTD 

       550        560        570        580        590        600 
SLRRLSKHYK DGSPITDDLL EKLVASRLVN TGLLTLRQIV LSKVDQSLHT NTSLDAASEY 

       610        620        630        640        650        660 
AKYCTEILGV AATPGTNMPA TFGHLAGGYD GQYYGYLWSE VFSMDMFYSC FKKEGIMNPE 

       670        680        690        700 
VGMKYRNLIL KPGGSLDGMD MLQNFLKREP NQKAFLMSRG LHAP 

« Hide

Isoform 2 [UniParc].

Checksum: EC451B8EAD4AC28F
Show »

FASTA74585,109
Isoform 3 (3') [UniParc].

Checksum: F7031443E3BCE573
Show »

FASTA68178,240
Isoform 4 (1') [UniParc].

Checksum: 28AA80A55D932547
Show »

FASTA9510,966
Isoform 5 (2') [UniParc].

Checksum: 805EA2F0EA783BB5
Show »

FASTA13615,318

References

[1]"Molecular cloning of porcine soluble angiotensin-binding protein."
Sugiura N., Hagiwara H., Hirose S.
J. Biol. Chem. 267:18067-18072(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PARTIAL PROTEIN SEQUENCE (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Heart and Liver.
[2]"Targeting of endopeptidase 24.16 to different subcellular compartments by alternative promoter usage."
Kato A., Sugiura N., Saruta Y., Hosoiri T., Yasue H., Hirose S.
J. Biol. Chem. 272:15313-15322(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4 AND 5), SUBCELLULAR LOCATION.
Tissue: Liver.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D11336 mRNA. Translation: BAA01949.1.
AB000170 mRNA. Translation: BAA19060.1.
AB000170 mRNA. Translation: BAA19061.1.
AB000171 mRNA. Translation: BAA19062.1.
AB000172 mRNA. Translation: BAA19063.1.
AB000172 mRNA. Translation: BAA19064.1.
AB000173 mRNA. Translation: BAA19065.1.
AB000174 mRNA. Translation: BAA19066.1.
AB000175 mRNA. Translation: BAA19067.1.
AB000425 Genomic DNA. Translation: BAA19104.1.
AB000425 Genomic DNA. Translation: BAA19105.1.
AB000425 Genomic DNA. Translation: BAA19106.1.
PIRA43411.
RefSeqNP_999524.1. NM_214359.2.
XP_005654268.1. XM_005654211.1.
XP_005654269.1. XM_005654212.1.
XP_005654270.1. XM_005654213.1.
XP_005672546.1. XM_005672489.1.
XP_005672547.1. XM_005672490.1.
XP_005672548.1. XM_005672491.1.
XP_005672549.1. XM_005672492.1.
XP_005672550.1. XM_005672493.1.
UniGeneSsc.54751.

3D structure databases

ProteinModelPortalQ02038.
SMRQ02038. Positions 37-701.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9823.ENSSSCP00000017959.

Protein family/group databases

MEROPSM03.002.

Proteomic databases

PaxDbQ02038.
PRIDEQ02038.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSSSCT00000025746; ENSSSCP00000022047; ENSSSCG00000016778. [Q02038-1]
GeneID100517788.
397646.
KEGGssc:100517788.
ssc:397646.

Organism-specific databases

CTD57486.

Phylogenomic databases

eggNOGCOG0339.
GeneTreeENSGT00550000074738.
HOGENOMHOG000245985.
HOVERGENHBG000238.
KOK01393.
OrthoDBEOG7SR4KW.

Family and domain databases

Gene3D1.10.1370.10. 2 hits.
1.20.1050.40. 1 hit.
3.40.390.10. 1 hit.
InterProIPR024079. MetalloPept_cat_dom.
IPR024077. Neurolysin/TOP_dom2.
IPR024080. Neurolysin/TOP_N.
IPR001567. Pept_M3A_M3B.
[Graphical view]
PfamPF01432. Peptidase_M3. 1 hit.
[Graphical view]
PROSITEPS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]
ProtoNetSearch...

Entry information

Entry nameNEUL_PIG
AccessionPrimary (citable) accession number: Q02038
Secondary accession number(s): P79433, Q7JK54
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: April 16, 2014
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries