Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q02038

- NEUL_PIG

UniProt

Q02038 - NEUL_PIG

Protein

Neurolysin, mitochondrial

Gene

NLN

Organism
Sus scrofa (Pig)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 1 (01 Oct 1993)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Binds angiotensins and its analogs.

    Catalytic activityi

    Preferential cleavage in neurotensin: 10-Pro-|-Tyr-11.

    Cofactori

    Binds 1 zinc ion per subunit.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi497 – 4971Zinc; catalyticPROSITE-ProRule annotation
    Active sitei498 – 4981PROSITE-ProRule annotation
    Metal bindingi501 – 5011Zinc; catalyticPROSITE-ProRule annotation
    Metal bindingi504 – 5041Zinc; catalyticPROSITE-ProRule annotation

    GO - Molecular functioni

    1. endopeptidase activity Source: UniProtKB
    2. metal ion binding Source: UniProtKB-KW
    3. metalloendopeptidase activity Source: InterPro

    Keywords - Molecular functioni

    Hydrolase, Metalloprotease, Protease

    Keywords - Ligandi

    Metal-binding, Zinc

    Protein family/group databases

    MEROPSiM03.002.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neurolysin, mitochondrial (EC:3.4.24.16)
    Alternative name(s):
    Endopeptidase 24.16
    Microsomal endopeptidase
    Short name:
    MEP
    Mitochondrial oligopeptidase M
    Neurotensin endopeptidase
    Soluble angiotensin-binding protein
    Short name:
    SABP
    Gene namesi
    Name:NLN
    OrganismiSus scrofa (Pig)
    Taxonomic identifieri9823 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaSuinaSuidaeSus
    ProteomesiUP000008227: Chromosome 16

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: UniProtKB
    2. mitochondrion Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Mitochondrion

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transit peptidei1 – 3737MitochondrionBy similarityAdd
    BLAST
    Chaini38 – 704667Neurolysin, mitochondrialPRO_0000028576Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei664 – 6641N6-acetyllysineBy similarity

    Keywords - PTMi

    Acetylation

    Proteomic databases

    PaxDbiQ02038.
    PRIDEiQ02038.

    Expressioni

    Tissue specificityi

    Predominantly expressed in the liver, kidney and adrenal gland.1 Publication

    Interactioni

    Protein-protein interaction databases

    STRINGi9823.ENSSSCP00000017959.

    Structurei

    3D structure databases

    ProteinModelPortaliQ02038.
    SMRiQ02038. Positions 37-701.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the peptidase M3 family.Curated

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    eggNOGiCOG0339.
    GeneTreeiENSGT00550000074738.
    HOGENOMiHOG000245985.
    HOVERGENiHBG000238.
    KOiK01393.
    OrthoDBiEOG7SR4KW.

    Family and domain databases

    Gene3Di1.10.1370.10. 2 hits.
    1.20.1050.40. 1 hit.
    3.40.390.10. 1 hit.
    InterProiIPR024079. MetalloPept_cat_dom.
    IPR024077. Neurolysin/TOP_dom2.
    IPR024080. Neurolysin/TOP_N.
    IPR001567. Pept_M3A_M3B.
    [Graphical view]
    PfamiPF01432. Peptidase_M3. 1 hit.
    [Graphical view]
    PROSITEiPS00142. ZINC_PROTEASE. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q02038-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIVRCLSAAR RLHRVGGSGI LLRMTLGREA MSPLQAMSSY TVDGRNVLRW    50
    DLSPEQIKRR TEELIAQTKQ VYDDIGMLDI EEVTYENCLQ ALADVEVKYI 100
    VERTMLDFPQ HVSSDKEVRA ASTEADKRLS RFDIEMSMRE DIFLRIVRLK 150
    ETCDLGKIKP EARRYLEKSV KMGKRNGLHL PEQVQNEIKA MKKRMSELCI 200
    DFNKNLNEDD TFLVFSKAEL GALPDDFIDS LEKTDDNKYK ITLKYPHYFP 250
    VMKKCCIPET RRKMEMAFNT RCKEENTIIL QELLPLRAKV AKLLGYSTHA 300
    DFVLEMNTAK STHHVTAFLD DLSQKLKPLG EAEREFILNL KKKECEEKGF 350
    EYDGKINAWD LHYYMTQTEE LKYSVDQEIL KEYFPIEVVT EGLLNIYQEL 400
    LGLSFEQVTD AHVWNKSVTL YTVKDKATGE VLGQFYLDLY PREGKYNHAA 450
    CFGLQPGCLL PDGSRMMSVA ALVVNFSQPR AGRPSLLRHD EVRTYFHEFG 500
    HVMHQICAQT DFARFSGTNV ETDFVEVPSQ MLENWVWDTD SLRRLSKHYK 550
    DGSPITDDLL EKLVASRLVN TGLLTLRQIV LSKVDQSLHT NTSLDAASEY 600
    AKYCTEILGV AATPGTNMPA TFGHLAGGYD GQYYGYLWSE VFSMDMFYSC 650
    FKKEGIMNPE VGMKYRNLIL KPGGSLDGMD MLQNFLKREP NQKAFLMSRG 700
    LHAP 704
    Length:704
    Mass (Da):80,757
    Last modified:October 1, 1993 - v1
    Checksum:iA02BFEC67B7044A1
    GO
    Isoform 2 (identifier: Q02038-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-14: MIVRCLSAARRLHR → MVYPEGHLARELGATFSSSAPLGGHPFPFVWDCLSCKQGDWSQARPKTNAERRSG

    Show »
    Length:745
    Mass (Da):85,109
    Checksum:iEC451B8EAD4AC28F
    GO
    Isoform 3 (identifier: Q02038-3) [UniParc]FASTAAdd to Basket

    Also known as: 3'

    The sequence of this isoform differs from the canonical sequence as follows:
         1-23: Missing.

    Show »
    Length:681
    Mass (Da):78,240
    Checksum:iF7031443E3BCE573
    GO
    Isoform 4 (identifier: Q02038-4) [UniParc]FASTAAdd to Basket

    Also known as: 1'

    The sequence of this isoform differs from the canonical sequence as follows:
         15-95: VGGSGILLRM...ENCLQALADV → ETPLSKFHIL...FKMGSFTRAN
         96-704: Missing.

    Note: Truncated due to inclusion of exon 4 which leads to premature stop codon.

    Show »
    Length:95
    Mass (Da):10,966
    Checksum:i28AA80A55D932547
    GO
    Isoform 5 (identifier: Q02038-5) [UniParc]FASTAAdd to Basket

    Also known as: 2'

    The sequence of this isoform differs from the canonical sequence as follows:
         1-136: MIVRCLSAAR...KRLSRFDIEM → MVYPEGHLAR...FKMGSFTRAN
         137-704: Missing.

    Note: Truncated due to inclusion of exon 4 which leads to premature stop codon.

    Show »
    Length:136
    Mass (Da):15,318
    Checksum:i805EA2F0EA783BB5
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 136136MIVRC…FDIEM → MVYPEGHLARELGATFSSSA PLGGHPFPFVWDCLSCKQGD WSQARPKTNAERRSGETPLS KFHILALVPLSILPVPRQKP GCHPESLTSSTHLGWWFRDF IENDFRERSNVSSSGNVFLY CGWQKCFKMGSFTRAN in isoform 5. CuratedVSP_019391Add
    BLAST
    Alternative sequencei1 – 2323Missing in isoform 3. CuratedVSP_019390Add
    BLAST
    Alternative sequencei1 – 1414MIVRC…RRLHR → MVYPEGHLARELGATFSSSA PLGGHPFPFVWDCLSCKQGD WSQARPKTNAERRSG in isoform 2. CuratedVSP_019392Add
    BLAST
    Alternative sequencei15 – 9581VGGSG…ALADV → ETPLSKFHILALVPLSILPV PRQKPGCHPESLTSSTHLGW WFRDFIENDFRERSNVSSSG NVFLYCGWQKCFKMGSFTRA N in isoform 4. CuratedVSP_019393Add
    BLAST
    Alternative sequencei96 – 704609Missing in isoform 4. CuratedVSP_019394Add
    BLAST
    Alternative sequencei137 – 704568Missing in isoform 5. CuratedVSP_019395Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D11336 mRNA. Translation: BAA01949.1.
    AB000170 mRNA. Translation: BAA19060.1.
    AB000170 mRNA. Translation: BAA19061.1.
    AB000171 mRNA. Translation: BAA19062.1.
    AB000172 mRNA. Translation: BAA19063.1.
    AB000172 mRNA. Translation: BAA19064.1.
    AB000173 mRNA. Translation: BAA19065.1.
    AB000174 mRNA. Translation: BAA19066.1.
    AB000175 mRNA. Translation: BAA19067.1.
    AB000425 Genomic DNA. Translation: BAA19104.1.
    AB000425 Genomic DNA. Translation: BAA19105.1.
    AB000425 Genomic DNA. Translation: BAA19106.1.
    PIRiA43411.
    RefSeqiNP_999524.1. NM_214359.2. [Q02038-1]
    XP_005654268.1. XM_005654211.1. [Q02038-3]
    XP_005654269.1. XM_005654212.1. [Q02038-3]
    XP_005654270.1. XM_005654213.1. [Q02038-3]
    XP_005672546.1. XM_005672489.1. [Q02038-3]
    XP_005672547.1. XM_005672490.1. [Q02038-3]
    XP_005672548.1. XM_005672491.1. [Q02038-3]
    XP_005672549.1. XM_005672492.1. [Q02038-3]
    XP_005672550.1. XM_005672493.1. [Q02038-3]
    UniGeneiSsc.54751.

    Genome annotation databases

    EnsembliENSSSCT00000025746; ENSSSCP00000022047; ENSSSCG00000016778. [Q02038-1]
    GeneIDi100517788.
    397646.
    KEGGissc:100517788.
    ssc:397646.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D11336 mRNA. Translation: BAA01949.1 .
    AB000170 mRNA. Translation: BAA19060.1 .
    AB000170 mRNA. Translation: BAA19061.1 .
    AB000171 mRNA. Translation: BAA19062.1 .
    AB000172 mRNA. Translation: BAA19063.1 .
    AB000172 mRNA. Translation: BAA19064.1 .
    AB000173 mRNA. Translation: BAA19065.1 .
    AB000174 mRNA. Translation: BAA19066.1 .
    AB000175 mRNA. Translation: BAA19067.1 .
    AB000425 Genomic DNA. Translation: BAA19104.1 .
    AB000425 Genomic DNA. Translation: BAA19105.1 .
    AB000425 Genomic DNA. Translation: BAA19106.1 .
    PIRi A43411.
    RefSeqi NP_999524.1. NM_214359.2. [Q02038-1 ]
    XP_005654268.1. XM_005654211.1. [Q02038-3 ]
    XP_005654269.1. XM_005654212.1. [Q02038-3 ]
    XP_005654270.1. XM_005654213.1. [Q02038-3 ]
    XP_005672546.1. XM_005672489.1. [Q02038-3 ]
    XP_005672547.1. XM_005672490.1. [Q02038-3 ]
    XP_005672548.1. XM_005672491.1. [Q02038-3 ]
    XP_005672549.1. XM_005672492.1. [Q02038-3 ]
    XP_005672550.1. XM_005672493.1. [Q02038-3 ]
    UniGenei Ssc.54751.

    3D structure databases

    ProteinModelPortali Q02038.
    SMRi Q02038. Positions 37-701.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9823.ENSSSCP00000017959.

    Protein family/group databases

    MEROPSi M03.002.

    Proteomic databases

    PaxDbi Q02038.
    PRIDEi Q02038.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSSSCT00000025746 ; ENSSSCP00000022047 ; ENSSSCG00000016778 . [Q02038-1 ]
    GeneIDi 100517788.
    397646.
    KEGGi ssc:100517788.
    ssc:397646.

    Organism-specific databases

    CTDi 57486.

    Phylogenomic databases

    eggNOGi COG0339.
    GeneTreei ENSGT00550000074738.
    HOGENOMi HOG000245985.
    HOVERGENi HBG000238.
    KOi K01393.
    OrthoDBi EOG7SR4KW.

    Family and domain databases

    Gene3Di 1.10.1370.10. 2 hits.
    1.20.1050.40. 1 hit.
    3.40.390.10. 1 hit.
    InterProi IPR024079. MetalloPept_cat_dom.
    IPR024077. Neurolysin/TOP_dom2.
    IPR024080. Neurolysin/TOP_N.
    IPR001567. Pept_M3A_M3B.
    [Graphical view ]
    Pfami PF01432. Peptidase_M3. 1 hit.
    [Graphical view ]
    PROSITEi PS00142. ZINC_PROTEASE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of porcine soluble angiotensin-binding protein."
      Sugiura N., Hagiwara H., Hirose S.
      J. Biol. Chem. 267:18067-18072(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PARTIAL PROTEIN SEQUENCE (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Heart and Liver.
    2. "Targeting of endopeptidase 24.16 to different subcellular compartments by alternative promoter usage."
      Kato A., Sugiura N., Saruta Y., Hosoiri T., Yasue H., Hirose S.
      J. Biol. Chem. 272:15313-15322(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4 AND 5), SUBCELLULAR LOCATION.
      Tissue: Liver.

    Entry informationi

    Entry nameiNEUL_PIG
    AccessioniPrimary (citable) accession number: Q02038
    Secondary accession number(s): P79433, Q7JK54
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1993
    Last sequence update: October 1, 1993
    Last modified: October 1, 2014
    This is version 98 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Peptidase families
      Classification of peptidase families and list of entries
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3