SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q02038

- NEUL_PIG

UniProt

Q02038 - NEUL_PIG

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neurolysin, mitochondrial

Gene
NLN
Organism
Sus scrofa (Pig)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Binds angiotensins and its analogs.

Catalytic activityi

Preferential cleavage in neurotensin: 10-Pro-|-Tyr-11.

Cofactori

Binds 1 zinc ion per subunit By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi497 – 4971Zinc; catalytic By similarity
Active sitei498 – 4981 By similarity
Metal bindingi501 – 5011Zinc; catalytic By similarity
Metal bindingi504 – 5041Zinc; catalytic By similarity

GO - Molecular functioni

  1. endopeptidase activity Source: UniProtKB
  2. metal ion binding Source: UniProtKB-KW
  3. metalloendopeptidase activity Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM03.002.

Names & Taxonomyi

Protein namesi
Recommended name:
Neurolysin, mitochondrial (EC:3.4.24.16)
Alternative name(s):
Endopeptidase 24.16
Microsomal endopeptidase
Short name:
MEP
Mitochondrial oligopeptidase M
Neurotensin endopeptidase
Soluble angiotensin-binding protein
Short name:
SABP
Gene namesi
Name:NLN
OrganismiSus scrofa (Pig)
Taxonomic identifieri9823 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaSuinaSuidaeSus
ProteomesiUP000008227: Chromosome 16

Subcellular locationi

Isoform 1 : Mitochondrion 1 Publication
Isoform 2 : Cytoplasm 1 Publication
Isoform 3 : Cytoplasm 1 Publication
Isoform 4 : Cytoplasm 1 Publication
Isoform 5 : Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytosol Source: UniProtKB
  2. mitochondrion Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 3737Mitochondrion By similarityAdd
BLAST
Chaini38 – 704667Neurolysin, mitochondrialPRO_0000028576Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei664 – 6641N6-acetyllysine By similarity

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ02038.
PRIDEiQ02038.

Expressioni

Tissue specificityi

Predominantly expressed in the liver, kidney and adrenal gland.1 Publication

Interactioni

Protein-protein interaction databases

STRINGi9823.ENSSSCP00000017959.

Structurei

3D structure databases

ProteinModelPortaliQ02038.
SMRiQ02038. Positions 37-701.

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M3 family.

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiCOG0339.
GeneTreeiENSGT00550000074738.
HOGENOMiHOG000245985.
HOVERGENiHBG000238.
KOiK01393.
OrthoDBiEOG7SR4KW.

Family and domain databases

Gene3Di1.10.1370.10. 2 hits.
1.20.1050.40. 1 hit.
3.40.390.10. 1 hit.
InterProiIPR024079. MetalloPept_cat_dom.
IPR024077. Neurolysin/TOP_dom2.
IPR024080. Neurolysin/TOP_N.
IPR001567. Pept_M3A_M3B.
[Graphical view]
PfamiPF01432. Peptidase_M3. 1 hit.
[Graphical view]
PROSITEiPS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q02038-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MIVRCLSAAR RLHRVGGSGI LLRMTLGREA MSPLQAMSSY TVDGRNVLRW    50
DLSPEQIKRR TEELIAQTKQ VYDDIGMLDI EEVTYENCLQ ALADVEVKYI 100
VERTMLDFPQ HVSSDKEVRA ASTEADKRLS RFDIEMSMRE DIFLRIVRLK 150
ETCDLGKIKP EARRYLEKSV KMGKRNGLHL PEQVQNEIKA MKKRMSELCI 200
DFNKNLNEDD TFLVFSKAEL GALPDDFIDS LEKTDDNKYK ITLKYPHYFP 250
VMKKCCIPET RRKMEMAFNT RCKEENTIIL QELLPLRAKV AKLLGYSTHA 300
DFVLEMNTAK STHHVTAFLD DLSQKLKPLG EAEREFILNL KKKECEEKGF 350
EYDGKINAWD LHYYMTQTEE LKYSVDQEIL KEYFPIEVVT EGLLNIYQEL 400
LGLSFEQVTD AHVWNKSVTL YTVKDKATGE VLGQFYLDLY PREGKYNHAA 450
CFGLQPGCLL PDGSRMMSVA ALVVNFSQPR AGRPSLLRHD EVRTYFHEFG 500
HVMHQICAQT DFARFSGTNV ETDFVEVPSQ MLENWVWDTD SLRRLSKHYK 550
DGSPITDDLL EKLVASRLVN TGLLTLRQIV LSKVDQSLHT NTSLDAASEY 600
AKYCTEILGV AATPGTNMPA TFGHLAGGYD GQYYGYLWSE VFSMDMFYSC 650
FKKEGIMNPE VGMKYRNLIL KPGGSLDGMD MLQNFLKREP NQKAFLMSRG 700
LHAP 704
Length:704
Mass (Da):80,757
Last modified:October 1, 1993 - v1
Checksum:iA02BFEC67B7044A1
GO
Isoform 2 (identifier: Q02038-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MIVRCLSAARRLHR → MVYPEGHLARELGATFSSSAPLGGHPFPFVWDCLSCKQGDWSQARPKTNAERRSG

Show »
Length:745
Mass (Da):85,109
Checksum:iEC451B8EAD4AC28F
GO
Isoform 3 (identifier: Q02038-3) [UniParc]FASTAAdd to Basket

Also known as: 3'

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: Missing.

Show »
Length:681
Mass (Da):78,240
Checksum:iF7031443E3BCE573
GO
Isoform 4 (identifier: Q02038-4) [UniParc]FASTAAdd to Basket

Also known as: 1'

The sequence of this isoform differs from the canonical sequence as follows:
     15-95: VGGSGILLRM...ENCLQALADV → ETPLSKFHIL...FKMGSFTRAN
     96-704: Missing.

Note: Truncated due to inclusion of exon 4 which leads to premature stop codon.

Show »
Length:95
Mass (Da):10,966
Checksum:i28AA80A55D932547
GO
Isoform 5 (identifier: Q02038-5) [UniParc]FASTAAdd to Basket

Also known as: 2'

The sequence of this isoform differs from the canonical sequence as follows:
     1-136: MIVRCLSAAR...KRLSRFDIEM → MVYPEGHLAR...FKMGSFTRAN
     137-704: Missing.

Note: Truncated due to inclusion of exon 4 which leads to premature stop codon.

Show »
Length:136
Mass (Da):15,318
Checksum:i805EA2F0EA783BB5
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 136136MIVRC…FDIEM → MVYPEGHLARELGATFSSSA PLGGHPFPFVWDCLSCKQGD WSQARPKTNAERRSGETPLS KFHILALVPLSILPVPRQKP GCHPESLTSSTHLGWWFRDF IENDFRERSNVSSSGNVFLY CGWQKCFKMGSFTRAN in isoform 5. VSP_019391Add
BLAST
Alternative sequencei1 – 2323Missing in isoform 3. VSP_019390Add
BLAST
Alternative sequencei1 – 1414MIVRC…RRLHR → MVYPEGHLARELGATFSSSA PLGGHPFPFVWDCLSCKQGD WSQARPKTNAERRSG in isoform 2. VSP_019392Add
BLAST
Alternative sequencei15 – 9581VGGSG…ALADV → ETPLSKFHILALVPLSILPV PRQKPGCHPESLTSSTHLGW WFRDFIENDFRERSNVSSSG NVFLYCGWQKCFKMGSFTRA N in isoform 4. VSP_019393Add
BLAST
Alternative sequencei96 – 704609Missing in isoform 4. VSP_019394Add
BLAST
Alternative sequencei137 – 704568Missing in isoform 5. VSP_019395Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D11336 mRNA. Translation: BAA01949.1.
AB000170 mRNA. Translation: BAA19060.1.
AB000170 mRNA. Translation: BAA19061.1.
AB000171 mRNA. Translation: BAA19062.1.
AB000172 mRNA. Translation: BAA19063.1.
AB000172 mRNA. Translation: BAA19064.1.
AB000173 mRNA. Translation: BAA19065.1.
AB000174 mRNA. Translation: BAA19066.1.
AB000175 mRNA. Translation: BAA19067.1.
AB000425 Genomic DNA. Translation: BAA19104.1.
AB000425 Genomic DNA. Translation: BAA19105.1.
AB000425 Genomic DNA. Translation: BAA19106.1.
PIRiA43411.
RefSeqiNP_999524.1. NM_214359.2. [Q02038-1]
XP_005654268.1. XM_005654211.1. [Q02038-3]
XP_005654269.1. XM_005654212.1. [Q02038-3]
XP_005654270.1. XM_005654213.1. [Q02038-3]
XP_005672546.1. XM_005672489.1. [Q02038-3]
XP_005672547.1. XM_005672490.1. [Q02038-3]
XP_005672548.1. XM_005672491.1. [Q02038-3]
XP_005672549.1. XM_005672492.1. [Q02038-3]
XP_005672550.1. XM_005672493.1. [Q02038-3]
UniGeneiSsc.54751.

Genome annotation databases

EnsembliENSSSCT00000025746; ENSSSCP00000022047; ENSSSCG00000016778. [Q02038-1]
GeneIDi100517788.
397646.
KEGGissc:100517788.
ssc:397646.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D11336 mRNA. Translation: BAA01949.1 .
AB000170 mRNA. Translation: BAA19060.1 .
AB000170 mRNA. Translation: BAA19061.1 .
AB000171 mRNA. Translation: BAA19062.1 .
AB000172 mRNA. Translation: BAA19063.1 .
AB000172 mRNA. Translation: BAA19064.1 .
AB000173 mRNA. Translation: BAA19065.1 .
AB000174 mRNA. Translation: BAA19066.1 .
AB000175 mRNA. Translation: BAA19067.1 .
AB000425 Genomic DNA. Translation: BAA19104.1 .
AB000425 Genomic DNA. Translation: BAA19105.1 .
AB000425 Genomic DNA. Translation: BAA19106.1 .
PIRi A43411.
RefSeqi NP_999524.1. NM_214359.2. [Q02038-1 ]
XP_005654268.1. XM_005654211.1. [Q02038-3 ]
XP_005654269.1. XM_005654212.1. [Q02038-3 ]
XP_005654270.1. XM_005654213.1. [Q02038-3 ]
XP_005672546.1. XM_005672489.1. [Q02038-3 ]
XP_005672547.1. XM_005672490.1. [Q02038-3 ]
XP_005672548.1. XM_005672491.1. [Q02038-3 ]
XP_005672549.1. XM_005672492.1. [Q02038-3 ]
XP_005672550.1. XM_005672493.1. [Q02038-3 ]
UniGenei Ssc.54751.

3D structure databases

ProteinModelPortali Q02038.
SMRi Q02038. Positions 37-701.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9823.ENSSSCP00000017959.

Protein family/group databases

MEROPSi M03.002.

Proteomic databases

PaxDbi Q02038.
PRIDEi Q02038.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSSSCT00000025746 ; ENSSSCP00000022047 ; ENSSSCG00000016778 . [Q02038-1 ]
GeneIDi 100517788.
397646.
KEGGi ssc:100517788.
ssc:397646.

Organism-specific databases

CTDi 57486.

Phylogenomic databases

eggNOGi COG0339.
GeneTreei ENSGT00550000074738.
HOGENOMi HOG000245985.
HOVERGENi HBG000238.
KOi K01393.
OrthoDBi EOG7SR4KW.

Family and domain databases

Gene3Di 1.10.1370.10. 2 hits.
1.20.1050.40. 1 hit.
3.40.390.10. 1 hit.
InterProi IPR024079. MetalloPept_cat_dom.
IPR024077. Neurolysin/TOP_dom2.
IPR024080. Neurolysin/TOP_N.
IPR001567. Pept_M3A_M3B.
[Graphical view ]
Pfami PF01432. Peptidase_M3. 1 hit.
[Graphical view ]
PROSITEi PS00142. ZINC_PROTEASE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Molecular cloning of porcine soluble angiotensin-binding protein."
    Sugiura N., Hagiwara H., Hirose S.
    J. Biol. Chem. 267:18067-18072(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PARTIAL PROTEIN SEQUENCE (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Heart and Liver.
  2. "Targeting of endopeptidase 24.16 to different subcellular compartments by alternative promoter usage."
    Kato A., Sugiura N., Saruta Y., Hosoiri T., Yasue H., Hirose S.
    J. Biol. Chem. 272:15313-15322(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4 AND 5), SUBCELLULAR LOCATION.
    Tissue: Liver.

Entry informationi

Entry nameiNEUL_PIG
AccessioniPrimary (citable) accession number: Q02038
Secondary accession number(s): P79433, Q7JK54
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: May 14, 2014
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi