Q01826 (SATB1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DNA-binding protein SATB1 Alternative name(s): Special AT-rich sequence-binding protein 1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 763 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Crucial silencing factor contributing to the initiation of X inactivation mediated by Xist RNA that occurs during embryogenesis and in lymphoma By similarity. Binds to DNA at special AT-rich sequences, the consensus SATB1-binding sequence (CSBS), at nuclear matrix- or scaffold-associated regions. Thought to recognize the sugar-phosphate structure of double-stranded DNA. Transcriptional repressor controlling nuclear and viral gene expression in a phosphorylated and acetylated status-dependent manner, by binding to matrix attachment regions (MARs) of DNA and inducing a local chromatin-loop remodeling. Acts as a docking site for several chromatin remodeling enzymes (e.g. PML at the MHC-I locus) and also by recruiting corepressors (HDACs) or coactivators (HATs) directly to promoters and enhancers. Modulates genes that are essential in the maturation of the immune T-cell CD8SP from thymocytes. Required for the switching of fetal globin species, and beta- and gamma-globin genes regulation during erythroid differentiation. Plays a role in chromatin organization and nuclear architecture during apoptosis. Interacts with the unique region (UR) of cytomegalovirus (CMV). Alu-like motifs and SATB1-binding sites provide a unique chromatin context which seems preferentially targeted by the HIV-1 integration machinery. Moreover, HIV-1 Tat may overcome SATB1-mediated repression of IL2 and IL2RA (interleukin) in T-cells by binding to the same domain than HDAC1. Delineates specific epigenetic modifications at target gene loci, directly upregulating metastasis-associated genes while downregulating tumor-suppressor genes. Reprograms chromatin organization and the transcription profiles of breast tumors to promote growth and metastasis. Ref.1 Ref.7 Ref.8 Ref.9 Ref.11 Ref.13 Ref.15 Ref.16 Ref.21 Ref.22 Ref.23 Ref.24 Ref.25 Ref.28 Ref.31 Ref.32 Ref.33 Ref.34 |
| Subunit structure | Interacts (via DNA-binding domains) with CUX1; leading to inhibit the attachment to DNA By similarity. Homodimer. Part of the nuclear protein complex gamma-globin promoter and enhancer binding factor (gamma-PE) composed at least by SATB1 and HOXB2. Interaction with CtBP1 when not acetylated stabalizes attachment to DNA and promotes transcription repression. Interacts with PCAF. Interacts with sumoylated PML, HDAC1 and HIV-1 Tat via the PDZ-like dimerization domain. Interacts also with DYNLT3 and POLR2J2. Binds to EP300. Ref.11 Ref.12 Ref.14 Ref.20 Ref.21 Ref.23 Ref.25 Ref.26 Ref.29 Ref.33 |
| Subcellular location | Nucleus matrix. Nucleus › PML body. Note: Organized into a cage-like network anchoring loops of heterochromatin and tethering specialized DNA sequences. When sumoylated, localized in promyelocytic leukemia nuclear bodies (PML NBs). Ref.1 Ref.10 Ref.15 Ref.17 Ref.19 Ref.20 Ref.27 |
| Tissue specificity | Expressed predominantly in thymus. Ref.1 |
| Post-translational modification | Sumoylated. Sumoylation promotes cleavage by caspases. Ref.18 Ref.27 Phosphorylated by PKC. Acetylated by PCAF. Phosphorylated form interacts with HDAC1, but unphosphorylated form interacts with PCAF. DNA binding properties are activated by phosphorylation and inactivated by acetylation. In opposition, gene expression is down-regulated by phosphorylation but up-regulated by acetylation. Ref.23 Cleaved at Asp-254 by caspase-3 and caspase-6 during T-cell apoptosis in thymus and during B-cell stimulation. The cleaved forms can not dimerize and lose transcription regulation function because of impaired DNA and chromatin association. Ref.10 Ref.11 Ref.22 Ref.27 |
| Sequence similarities | Belongs to the CUT homeobox family. Contains 2 CUT DNA-binding domains. Contains 1 homeobox DNA-binding domain. |
| Sequence caution | The sequence BAD92998.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CASP6 | P55212 | 2 | EBI-743747,EBI-718729 | |
| SUMO1 | P63165 | 2 | EBI-743747,EBI-80140 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q01826-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q01826-2) The sequence of this isoform differs from the canonical sequence as follows: 592-592: I → IQSPSPTTLGKGESRGVFLPGLPTPAPWLGAAP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||
Molecule processing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 763 | 763 | DNA-binding protein SATB1 | PRO_0000202398 | |||||||||||||||
Regions | |||||||||||||||||||
| DNA binding | 361 – 448 | 88 | CUT 1 | ||||||||||||||||
| DNA binding | 484 – 571 | 88 | CUT 2 | ||||||||||||||||
| DNA binding | 645 – 704 | 60 | Homeobox | ||||||||||||||||
| Region | 90 – 204 | 115 | PDZ-like dimerization domain | ||||||||||||||||
| Region | 224 – 278 | 55 | Nuclear matrix targeting sequence (NMTS) | ||||||||||||||||
| Region | 400 – 410 | 11 | Matrix attachment region (MAR) DNA-binding | ||||||||||||||||
| Motif | 20 – 40 | 21 | Nuclear localization signal Ref.17 | ||||||||||||||||
| Motif | 139 – 143 | 5 | Protein interaction | ||||||||||||||||
| Compositional bias | 591 – 607 | 17 | Poly-Gln | ||||||||||||||||
| Compositional bias | 609 – 614 | 6 | Poly-Pro | ||||||||||||||||
Sites | |||||||||||||||||||
| Binding site | 390 | 1 | Matrix attachment region (MAR) DNA | ||||||||||||||||
| Binding site | 425 | 1 | Matrix attachment region (MAR) DNA | ||||||||||||||||
| Site | 254 – 255 | 2 | Cleavage; by caspases | ||||||||||||||||
Amino acid modifications | |||||||||||||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.30 | ||||||||||||||||
| Modified residue | 136 | 1 | N6-acetyllysine Ref.23 | ||||||||||||||||
| Modified residue | 185 | 1 | Phosphoserine Ref.23 | ||||||||||||||||
| Cross-link | 744 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.27 | |||||||||||||||||
Natural variations | |||||||||||||||||||
| Alternative sequence | 592 | 1 | I → IQSPSPTTLGKGESRGVFLP GLPTPAPWLGAAP in isoform 2. | VSP_038296 | |||||||||||||||
Experimental info | |||||||||||||||||||
| Mutagenesis | 29 | 1 | K → A: Loss of nuclear localization, cytoplasmic. Ref.17 | ||||||||||||||||
| Mutagenesis | 32 | 1 | R → A: Loss of nuclear localization, cytoplasmic. Ref.17 | ||||||||||||||||
| Mutagenesis | 34 | 1 | E → A: Normal nuclear localization. Ref.17 | ||||||||||||||||
| Mutagenesis | 36 | 1 | N → A: Normal nuclear localization. Ref.17 | ||||||||||||||||
| Mutagenesis | 136 | 1 | K → A, Q or R: No acetylation. Ref.23 Ref.33 | ||||||||||||||||
| Mutagenesis | 185 | 1 | S → A: No phosphorylation. Ref.23 | ||||||||||||||||
| Mutagenesis | 254 | 1 | D → A: CASP6-resistant. Ref.11 | ||||||||||||||||
| Mutagenesis | 373 | 1 | S → A: Slightly reduced MAR-DNA-binding. Ref.35 | ||||||||||||||||
| Mutagenesis | 380 | 1 | R → N: Reduced MAR-DNA-binding. Ref.35 | ||||||||||||||||
| Mutagenesis | 384 | 1 | K → N: Impaired MAR-DNA-binding. Ref.35 | ||||||||||||||||
| Mutagenesis | 395 | 1 | R → N: Reduced MAR-DNA-binding. Ref.35 | ||||||||||||||||
| Mutagenesis | 402 | 1 | Q → A: Impaired MAR-DNA-binding. Ref.36 | ||||||||||||||||
| Mutagenesis | 403 | 1 | G → A: Impaired MAR-DNA-binding. Ref.36 | ||||||||||||||||
| Mutagenesis | 406 | 1 | S → A: Impaired MAR-DNA-binding. Ref.35 | ||||||||||||||||
| Mutagenesis | 410 | 1 | R → N: Impaired MAR-DNA-binding. Ref.35 | ||||||||||||||||
| Mutagenesis | 411 | 1 | K → R: Normal sumoylation. Ref.27 | ||||||||||||||||
| Mutagenesis | 416 | 1 | K → N: Impaired MAR-DNA-binding. Ref.35 | ||||||||||||||||
| Mutagenesis | 427 | 1 | R → N: Reduced MAR-DNA-binding. Ref.35 | ||||||||||||||||
| Mutagenesis | 442 | 1 | R → N: Reduced MAR-DNA-binding. Ref.35 | ||||||||||||||||
| Mutagenesis | 451 | 1 | S → A: Slightly reduced MAR-DNA-binding. Ref.35 | ||||||||||||||||
| Mutagenesis | 475 | 1 | K → N: Reduced MAR-DNA-binding. Ref.35 | ||||||||||||||||
| Mutagenesis | 486 | 1 | K → R: Normal sumoylation. Ref.27 | ||||||||||||||||
| Mutagenesis | 646 | 1 | R → A: Reduced interaction with matrix attachment region (MAR) DNA; when associated with A-648. Ref.7 | ||||||||||||||||
| Mutagenesis | 648 | 1 | R → A: Reduced interaction with matrix attachment region (MAR) DNA; when associated with A-646. Ref.7 | ||||||||||||||||
| Mutagenesis | 693 – 695 | 3 | FQN → AAA: Reduced interaction with matrix attachment region (MAR) DNA. Ref.7 | ||||||||||||||||
| Mutagenesis | 720 | 1 | K → R: Normal sumoylation. Ref.27 | ||||||||||||||||
| Mutagenesis | 744 | 1 | K → R: Loss of sumoylation. Ref.27 | ||||||||||||||||
Secondary structure | |||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||
| Helix | 375 – 386 | 12 | |||||||||||||||||
| Helix | 390 – 398 | 9 | |||||||||||||||||
| Helix | 402 – 411 | 10 | |||||||||||||||||
| Helix | 415 – 417 | 3 | |||||||||||||||||
| Helix | 420 – 433 | 14 | |||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A tissue-specific MAR/SAR DNA-binding protein with unusual binding site recognition." Dickinson L.A., Joh T., Kohwi Y., Kohwi-Shigematsu T. Cell 70:631-645(1992) [PubMed: 1505028] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hippocampus. |
| [3] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno F.R. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [4] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| [7] | "An atypical homeodomain in SATB1 promotes specific recognition of the key structural element in a matrix attachment region." Dickinson L.A., Dickinson C.D., Kohwi-Shigematsu T. J. Biol. Chem. 272:11463-11470(1997) [PubMed: 9111059] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF ARG-646; ARG-648 AND 693-PHE--ASN-695. |
| [8] | "The genomic sequences bound to special AT-rich sequence-binding protein 1 (SATB1) in vivo in Jurkat T cells are tightly associated with the nuclear matrix at the bases of the chromatin loops." de Belle I., Cai S., Kohwi-Shigematsu T. J. Cell Biol. 141:335-348(1998) [PubMed: 9548713] [Abstract] Cited for: FUNCTION. |
| [9] | "The gammaPE complex contains both SATB1 and HOXB2 and has positive and negative roles in human gamma-globin gene regulation." Case S.S., Huber P., Lloyd J.A. DNA Cell Biol. 18:805-817(1999) [PubMed: 10595394] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN THE GAMMA-GLOBIN PROMOTER COMPLEX, IDENTIFICATION IN THE ENHANCER BINDING FACTOR COMPLEX. |
| [10] | "The fate of the nuclear matrix-associated-region-binding protein SATB1 during apoptosis." Gotzmann J., Meissner M., Gerner C. Cell Death Differ. 7:425-438(2000) [PubMed: 10800076] [Abstract] Cited for: CLEAVAGE BY CASPASES, SUBCELLULAR LOCATION. |
| [11] | "SATB1 cleavage by caspase 6 disrupts PDZ domain-mediated dimerization, causing detachment from chromatin early in T-cell apoptosis." Galande S., Dickinson L.A., Mian I.S., Sikorska M., Kohwi-Shigematsu T. Mol. Cell. Biol. 21:5591-5604(2001) [PubMed: 11463840] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF ASP-254, SUBUNIT, CLEAVAGE BY CASPASE-6. |
| [12] | "The thymocyte-specific MAR binding protein, SATB1, interacts in vitro with a novel variant of DNA-directed RNA polymerase II, subunit 11." Durrin L.K., Krontiris T.G. Genomics 79:809-817(2002) [PubMed: 12036295] [Abstract] Cited for: INTERACTION WITH POLR2J2. |
| [13] | "SATB1 targets chromatin remodelling to regulate genes over long distances." Yasui D., Miyano M., Cai S., Varga-Weisz P., Kohwi-Shigematsu T. Nature 419:641-645(2002) [PubMed: 12374985] [Abstract] Cited for: FUNCTION. |
| [14] | "SATB1 makes a complex with p300 and represses gp91(phox) promoter activity." Fujii Y., Kumatori A., Nakamura M. Microbiol. Immunol. 47:803-811(2003) [PubMed: 14605447] [Abstract] Cited for: INTERACTION WITH EP300. |
| [15] | "Tissue-specific nuclear architecture and gene expression regulated by SATB1." Cai S., Han H.-J., Kohwi-Shigematsu T. Nat. Genet. 34:42-51(2003) [PubMed: 12692553] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [16] | "SATB1 family protein expressed during early erythroid differentiation modifies globin gene expression." Wen J., Huang S., Rogers H., Dickinson L.A., Kohwi-Shigematsu T., Noguchi C.T. Blood 105:3330-3339(2005) [PubMed: 15618465] [Abstract] Cited for: FUNCTION. |
| [17] | "A nuclear targeting determinant for SATB1, a genome organizer in the T cell lineage." Nakayama Y., Mian I.S., Kohwi-Shigematsu T., Ogawa T. Cell Cycle 4:1099-1106(2005) [PubMed: 15970696] [Abstract] Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-29; ARG-32; GLU-34 AND ASN-36, NUCLEAR LOCALIZATION SIGNAL. |
| [18] | "Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates." Gocke C.B., Yu H., Kang J. J. Biol. Chem. 280:5004-5012(2005) [PubMed: 15561718] [Abstract] Cited for: SUMOYLATION. |
| [19] | "Nuclear matrix binding regulates SATB1-mediated transcriptional repression." Seo J., Lozano M.M., Dudley J.P. J. Biol. Chem. 280:24600-24609(2005) [PubMed: 15851481] [Abstract] Cited for: SUBCELLULAR LOCATION, NUCLEAR MATRIX TARGETING SEQUENCE. |
| [20] | "Dynein light chain rp3 acts as a nuclear matrix-associated transcriptional modulator in a dynein-independent pathway." Yeh T.-Y., Chuang J.-Z., Sung C.-H. J. Cell Sci. 118:3431-3443(2005) [PubMed: 16079286] [Abstract] Cited for: INTERACTION WITH DYNLT3, SUBCELLULAR LOCATION. |
| [21] | "Displacement of SATB1-bound histone deacetylase 1 corepressor by the human immunodeficiency virus type 1 transactivator induces expression of interleukin-2 and its receptor in T cells." Kumar P.P., Purbey P.K., Ravi D.S., Mitra D., Galande S. Mol. Cell. Biol. 25:1620-1633(2005) [PubMed: 15713622] [Abstract] Cited for: FUNCTION, INTERACTION WITH HIV-1 TAT AND HDAC1. |
| [22] | "The behavior of SATB1, a MAR-binding protein, in response to apoptosis stimulation." Sun Y., Wang T., Su Y., Yin Y., Xu S., Ma C., Han X. Cell Biol. Int. 30:244-247(2006) [PubMed: 16377216] [Abstract] Cited for: FUNCTION, CLEAVAGE BY CASPASE-3. |
| [23] | "Phosphorylation of SATB1, a global gene regulator, acts as a molecular switch regulating its transcriptional activity in vivo." Kumar P.P., Purbey P.K., Sinha C.K., Notani D., Limaye A., Jayani R.S., Galande S. Mol. Cell 22:231-243(2006) [PubMed: 16630892] [Abstract] Cited for: FUNCTION, MASS SPECTROMETRY, INTERACTION WITH HDAC1 AND PCAF, MUTAGENESIS OF LYS-136 AND SER-185, ACETYLATION AT LYS-136, PHOSPHORYLATION AT SER-185. |
| [24] | "SATB1-binding sequences and Alu-like motifs define a unique chromatin context in the vicinity of human immunodeficiency virus type 1 integration sites." Kumar P.P., Mehta S., Purbey P.K., Notani D., Jayani R.S., Purohit H.J., Raje D.V., Ravi D.S., Bhonde R.R., Mitra D., Galande S. J. Virol. 81:5617-5627(2007) [PubMed: 17376900] [Abstract] Cited for: FUNCTION. |
| [25] | "Functional interaction between PML and SATB1 regulates chromatin-loop architecture and transcription of the MHC class I locus." Kumar P.P., Bischof O., Purbey P.K., Notani D., Urlaub H., Dejean A., Galande S. Nat. Cell Biol. 9:45-56(2007) [PubMed: 17173041] [Abstract] Cited for: FUNCTION, INTERACTION WITH PML. |
| [26] | "Cellular homeoproteins, SATB1 and CDP, bind to the unique region between the human cytomegalovirus UL127 and major immediate-early genes." Lee J., Klase Z., Gao X., Caldwell J.S., Stinski M.F., Kashanchi F., Chao S.-H. Virology 366:117-125(2007) [PubMed: 17512569] [Abstract] Cited for: INTERACTION WITH CYTOMEGALOVIRUS UNIQUE REGION. |
| [27] | "SUMO conjugation to the matrix attachment region-binding protein, special AT-rich sequence-binding protein-1 (SATB1), targets SATB1 to promyelocytic nuclear bodies where it undergoes caspase cleavage." Tan J.-A.T., Sun Y., Song J., Chen Y., Krontiris T.G., Durrin L.K. J. Biol. Chem. 283:18124-18134(2008) [PubMed: 18408014] [Abstract] Cited for: SUMOYLATION AT LYS-744, MUTAGENESIS OF LYS-411; LYS-486; LYS-720 AND LYS-744, SUBCELLULAR LOCATION, CLEAVAGE BY CASPASE-6. |
| [28] | "SATB1 reprogrammes gene expression to promote breast tumour growth and metastasis." Han H.-J., Russo J., Kohwi Y., Kohwi-Shigematsu T. Nature 452:187-193(2008) [PubMed: 18337816] [Abstract] Cited for: FUNCTION, ROLE IN BREAST TUMOR GROWTH AND METASTASIS. |
| [29] | "PDZ domain-mediated dimerization and homeodomain-directed specificity are required for high-affinity DNA binding by SATB1." Purbey P.K., Singh S., Kumar P.P., Mehta S., Ganesh K.N., Mitra D., Galande S. Nucleic Acids Res. 36:2107-2122(2008) [PubMed: 18187506] [Abstract] Cited for: SUBUNIT, INTERACTION WITH DNA AND NUCLEAR MATRIX. |
| [30] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [31] | "SATB1 regulates beta-like globin genes through matrix related nuclear relocation of the cluster." Gong H., Wang Z., Zhao G.-W., Lv X., Wei G.-H., Wang L., Liu D.-P., Liang C.-C. Biochem. Biophys. Res. Commun. 383:11-15(2009) [PubMed: 19332023] [Abstract] Cited for: FUNCTION. |
| [32] | "SATB1 binds an intronic MAR sequence in human PI3kgamma in vitro." Cai R., Xu W., Dai B., Cai X., Xu R., Lu J. Mol. Biol. Rep. 37:1461-1465(2010) [PubMed: 19430959] [Abstract] Cited for: FUNCTION. |
| [33] | "Acetylation-dependent interaction of SATB1 and CtBP1 mediates transcriptional repression by SATB1." Purbey P.K., Singh S., Notani D., Kumar P.P., Limaye A.S., Galande S. Mol. Cell. Biol. 29:1321-1337(2009) [PubMed: 19103759] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF LYS-136, INTERACTION WITH CTBP1. |
| [34] | "Inter-MAR association contributes to transcriptionally active looping events in human beta-globin gene cluster." Wang L., Di L.-J., Lv X., Zheng W., Xue Z., Guo Z.-C., Liu D.-P., Liang C.-C. PLoS ONE 4:E4629-E4629(2009) [PubMed: 19247486] [Abstract] Cited for: FUNCTION. |
| [35] | "Solution structure and DNA-binding mode of the matrix attachment region-binding domain of the transcription factor SATB1 that regulates the T-cell maturation." Yamaguchi H., Tateno M., Yamasaki K. J. Biol. Chem. 281:5319-5327(2006) [PubMed: 16371359] [Abstract] Cited for: STRUCTURE BY NMR OF 353-490 IN COMPLEX WITH MAR DNA, MUTAGENESIS OF SER-373; ARG-380; LYS-384; ARG-395; SER-406; ARG-410; LYS-416; ARG-427; ARG-442; SER-451 AND LYS-475. |
| [36] | "Structural basis for recognition of the matrix attachment region of DNA by transcription factor SATB1." Yamasaki K., Akiba T., Yamasaki T., Harata K. Nucleic Acids Res. 35:5073-5084(2007) [PubMed: 17652321] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 368-452 IN COMPLEX WITH MAR DNA, MUTAGENESIS OF GLN-402 AND GLY-403. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M97287 mRNA. Translation: AAA60304.1. AK127242 mRNA. Translation: BAG54463.1. AB209761 mRNA. Translation: BAD92998.1. Different initiation. AC139618 Genomic DNA. No translation available. AC144521 Genomic DNA. No translation available. CH471055 Genomic DNA. Translation: EAW64291.1. BC001744 mRNA. Translation: AAH01744.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00009804. IPI00555719. | ||||||||||||||||||||||||||||||||||||
| PIR | A43314. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001124482.1. NM_001131010.2. NP_001182399.1. NM_001195470.1. NP_002962.1. NM_002971.4. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.517717. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q01826. | ||||||||||||||||||||||||||||||||||||
| SMR | Q01826. Positions 179-250, 370-452, 486-573, 646-704. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| DIP | DIP-48757N. | ||||||||||||||||||||||||||||||||||||
| IntAct | Q01826. 9 interactions. | ||||||||||||||||||||||||||||||||||||
| MINT | MINT-1478608. | ||||||||||||||||||||||||||||||||||||
| STRING | Q01826. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q01826. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 417747. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PRIDE | Q01826. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000332610; ENSP00000333367; ENSG00000182568. ENST00000338745; ENSP00000341024; ENSG00000182568. ENST00000454909; ENSP00000399708; ENSG00000182568. | ||||||||||||||||||||||||||||||||||||
| GeneID | 6304. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:6304. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc003cbh.1. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 6304. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC03M018364. | ||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0017285. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:10541. SATB1. | ||||||||||||||||||||||||||||||||||||
| HPA | CAB023814. | ||||||||||||||||||||||||||||||||||||
| MIM | 602075. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q01826. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA34951. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG17957. | ||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00390000008096. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG054240. | ||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4BVRT9. | ||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q01826. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. | ||||||||||||||||||||||||||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q01826. | ||||||||||||||||||||||||||||||||||||
| Bgee | Q01826. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_SATB1. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | Q01826. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000182568. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| InterPro | IPR003350. Hmoeo_CUT. IPR001356. Homeobox. IPR009057. Homeodomain-like. IPR012287. Homeodomain-rel. IPR010982. Lambda_DNA-bd. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.10.260.40. G3DSA:1.10.260.40. 2 hits. G3DSA:1.10.10.60. Homeodomain-rel. 1 hit. | ||||||||||||||||||||||||||||||||||||
| Pfam | PF02376. CUT. 2 hits. PF00046. Homeobox. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SMART | SM00389. HOX. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF46689. Homeodomain_like. 1 hit. SSF47413. Lambda_like_DNA. 2 hits. | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS51042. CUT. 2 hits. PS00027. HOMEOBOX_1. False negative. PS50071. HOMEOBOX_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| NextBio | 24475. | ||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | Q01826. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SATB1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q01826 Secondary accession number(s): B3KXF1, C9JTR6, Q59EQ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with