Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/calcium exchanger 1

Gene

Slc8a1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mediates the exchange of one Ca2+ ion against three to four Na+ ions across the cell membrane, and thereby contributes to the regulation of cytoplasmic Ca2+ levels and Ca2+-dependent cellular processes (PubMed:8422940, PubMed:8454039, PubMed:10894800, PubMed:12502557). Contributes to Ca2+ transport during excitation-contraction coupling in muscle. In a first phase, voltage-gated channels mediate the rapid increase of cytoplasmic Ca2+ levels due to release of Ca2+ stores from the endoplasmic reticulum. SLC8A1 mediates the export of Ca2+ from the cell during the next phase, so that cytoplasmic Ca2+ levels rapidly return to baseline. Required for normal embryonic heart development and the onset of heart contractions (By similarity).By similarity5 Publications

Enzyme regulationi

Activated by micromolar levels of Ca2+ (PubMed:12502557). Isoform 4 and isoform 6 are only active at low calcium concentrations but isoform 5 is active at all calcium levels tested. Isoform 5 and isoform 6, but not isoform 4, are activated by PKC (PubMed:15040000).2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi417Calcium 1By similarity1
Metal bindingi417Calcium 2By similarity1
Metal bindingi417Calcium 3By similarity1
Metal bindingi453Calcium 1By similarity1
Metal bindingi453Calcium 4By similarity1
Metal bindingi478Calcium 2By similarity1
Metal bindingi479Calcium 1By similarity1
Metal bindingi479Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi479Calcium 3By similarity1
Metal bindingi479Calcium 4By similarity1
Metal bindingi481Calcium 3; via carbonyl oxygenBy similarity1
Metal bindingi483Calcium 1By similarity1
Metal bindingi483Calcium 3By similarity1
Metal bindingi483Calcium 4By similarity1
Metal bindingi486Calcium 4By similarity1
Metal bindingi530Calcium 3By similarity1
Metal bindingi531Calcium 2By similarity1
Metal bindingi532Calcium 2By similarity1
Metal bindingi532Calcium 3By similarity1
Metal bindingi548Calcium 5By similarity1
Metal bindingi584Calcium 6By similarity1
Metal bindingi610Calcium 5By similarity1
Metal bindingi610Calcium 6By similarity1
Metal bindingi611Calcium 6By similarity1
Metal bindingi612Calcium 5; via carbonyl oxygenBy similarity1
Metal bindingi612Calcium 6By similarity1
Metal bindingi716Calcium 5By similarity1

GO - Molecular functioni

  • calcium:sodium antiporter activity Source: BHF-UCL
  • calcium ion binding Source: UniProtKB

GO - Biological processi

  • calcium ion export Source: BHF-UCL
  • calcium ion import Source: BHF-UCL
  • calcium ion transmembrane transport Source: RGD
  • calcium ion transport Source: RGD
  • calcium ion transport into cytosol Source: RGD
  • cell communication by electrical coupling involved in cardiac conduction Source: BHF-UCL
  • cellular calcium ion homeostasis Source: RGD
  • cellular response to cAMP Source: RGD
  • cellular response to hypoxia Source: RGD
  • cellular response to reactive oxygen species Source: BHF-UCL
  • cellular sodium ion homeostasis Source: Ensembl
  • positive regulation of bone mineralization Source: Ensembl
  • positive regulation of cytosolic calcium ion concentration Source: RGD
  • positive regulation of fibroblast migration Source: RGD
  • positive regulation of the force of heart contraction Source: Ensembl
  • regulation of calcium ion transport Source: RGD
  • regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion Source: BHF-UCL
  • regulation of sodium ion transport Source: RGD
  • response to ATP Source: RGD
  • response to drug Source: RGD
  • response to glucose Source: RGD
  • response to hydrogen peroxide Source: RGD
  • response to hypoxia Source: RGD
  • response to immobilization stress Source: RGD
  • response to muscle stretch Source: Ensembl
  • response to nutrient Source: RGD
  • sodium ion export Source: BHF-UCL
  • sodium ion import Source: BHF-UCL
  • sodium ion transport Source: RGD
  • telencephalon development Source: RGD
Complete GO annotation...

Keywords - Biological processi

Antiport, Calcium transport, Ion transport, Sodium transport, Transport

Keywords - Ligandi

Calcium, Calmodulin-binding, Metal-binding, Sodium

Enzyme and pathway databases

ReactomeiR-RNO-418359. Reduction of cytosolic Ca++ levels.
R-RNO-425561. Sodium/Calcium exchangers.
R-RNO-5578775. Ion homeostasis.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/calcium exchanger 1
Alternative name(s):
Na(+)/Ca(2+)-exchange protein 1
Solute carrier family 8 member 1
Gene namesi
Name:Slc8a1
Synonyms:Ncx1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 6

Organism-specific databases

RGDi3717. Slc8a1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini33 – 71ExtracellularSequence analysisAdd BLAST39
Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Topological domaini93 – 133CytoplasmicSequence analysisAdd BLAST41
Transmembranei134 – 154HelicalSequence analysisAdd BLAST21
Topological domaini155 – 167ExtracellularSequence analysisAdd BLAST13
Transmembranei168 – 188HelicalSequence analysisAdd BLAST21
Topological domaini189 – 201CytoplasmicSequence analysisAdd BLAST13
Transmembranei202 – 222HelicalSequence analysisAdd BLAST21
Topological domaini223 – 228ExtracellularSequence analysis6
Transmembranei229 – 249HelicalSequence analysisAdd BLAST21
Topological domaini250 – 798CytoplasmicSequence analysisAdd BLAST549
Transmembranei799 – 819HelicalSequence analysisAdd BLAST21
Topological domaini820 – 822ExtracellularSequence analysis3
Transmembranei823 – 843HelicalSequence analysisAdd BLAST21
Topological domaini844 – 872CytoplasmicSequence analysisAdd BLAST29
Transmembranei873 – 893HelicalSequence analysisAdd BLAST21
Topological domaini894 – 904ExtracellularSequence analysisAdd BLAST11
Transmembranei905 – 925HelicalSequence analysisAdd BLAST21
Topological domaini926 – 942CytoplasmicSequence analysisAdd BLAST17
Transmembranei943 – 963HelicalSequence analysisAdd BLAST21
Topological domaini964 – 971ExtracellularSequence analysis8

GO - Cellular componenti

  • cell projection Source: RGD
  • dendritic shaft Source: RGD
  • dendritic spine Source: RGD
  • integral component of plasma membrane Source: Ensembl
  • intercalated disc Source: BHF-UCL
  • intrinsic component of plasma membrane Source: UniProtKB
  • microtubule Source: RGD
  • mitochondrion Source: RGD
  • plasma membrane Source: RGD
  • sarcolemma Source: BHF-UCL
  • T-tubule Source: BHF-UCL
  • Z disc Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 32Sequence analysisAdd BLAST32
ChainiPRO_000001938133 – 971Sodium/calcium exchanger 1Add BLAST939

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi41N-linked (GlcNAc...)Sequence analysis1
Glycosylationi157N-linked (GlcNAc...)Sequence analysis1
Modified residuei282PhosphoserineBy similarity1
Modified residuei389PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ01728.
PRIDEiQ01728.

PTM databases

iPTMnetiQ01728.
PhosphoSitePlusiQ01728.
SwissPalmiQ01728.

Expressioni

Tissue specificityi

Detected in heart, brain cortex and hippocampus (at protein level) (PubMed:16914199). Cardiac sarcolemma or brain, and spleen. Expressed in all regions of the kidney, highest levels of expression in the distal convoluted tubule. Expressed throughout the CNS, in decreasing order of abundance in hippocampus, cortex, cerebellum, hypothalamus, midbrain and striatum. Expressed in numerous regions of the brain including multiple cortical layers, hippocampus, septal nuclei, thalamic nuclei, cerebellum, hypothalamus, olfactory bulb and brainstem. Also expressed in various regions of the spinal cord, ventricles and atria of the heart, lung, adrenals and kidney. Isoform 4 seems to be a predominant isoform in aorta, stomach, liver, and kidney.5 Publications

Gene expression databases

ExpressionAtlasiQ01728. baseline and differential.
GenevisibleiQ01728. RN.

Interactioni

Protein-protein interaction databases

BioGridi248332. 9 interactors.
IntActiQ01728. 1 interactor.
MINTiMINT-4563844.
STRINGi10116.ENSRNOP00000040751.

Structurei

3D structure databases

ProteinModelPortaliQ01728.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati138 – 178Alpha-1Add BLAST41
Domaini393 – 493Calx-beta 1Add BLAST101
Domaini524 – 624Calx-beta 2Add BLAST101
Repeati840 – 876Alpha-2Add BLAST37

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni251 – 270Putative calmodulin-binding regionBy similarityAdd BLAST20

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi236 – 239Poly-Phe4
Compositional biasi690 – 693Poly-Glu4
Compositional biasi757 – 761Poly-Asp5

Domaini

The cytoplasmic Calx-beta domains bind the regulatory Ca2+. The first Calx-beta domain can bind up to four Ca2+ ions. The second domain can bind another two Ca2+ ions that are essential for calcium-regulated ion exchange.By similarity

Sequence similaritiesi

Contains 2 Calx-beta domains.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1306. Eukaryota.
ENOG410XPJP. LUCA.
GeneTreeiENSGT00730000110414.
HOGENOMiHOG000266971.
HOVERGENiHBG006441.
InParanoidiQ01728.
KOiK05849.
OMAiDDEECGE.
OrthoDBiEOG091G0EC1.
PhylomeDBiQ01728.
TreeFamiTF314308.

Family and domain databases

InterProiIPR003644. Calx_beta.
IPR001623. DnaJ_domain.
IPR004836. Na_Ca_Ex.
IPR032452. Na_Ca_Ex_C-exten.
IPR002987. NaCa_exhngr1.
IPR004837. NaCa_Exmemb.
[Graphical view]
PfamiPF03160. Calx-beta. 2 hits.
PF01699. Na_Ca_ex. 2 hits.
PF16494. Na_Ca_ex_C. 1 hit.
[Graphical view]
PRINTSiPR01259. NACAEXCHNGR.
PR01260. NACAEXCHNGR1.
SMARTiSM00237. Calx_beta. 2 hits.
[Graphical view]
TIGRFAMsiTIGR00845. caca. 1 hit.

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q01728-1) [UniParc]FASTAAdd to basket
Also known as: Heart, NaCa1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLRLSLPPNV SMGFRLVTLV ALLFTHVDHI TADTEAETGG NETTECTGSY
60 70 80 90 100
YCKKGVILPI WEPQDPSFGD KIARATVYFV AMVYMFLGVS IIADRFMSSI
110 120 130 140 150
EVITSQEKEI TIKKPNGETT KTTVRIWNET VSNLTLMALG SSAPEILLSV
160 170 180 190 200
IEVCGHNFTA GDLGPSTIVG SAAFNMFIII ALCVYVVPDG ETRKIKHLRV
210 220 230 240 250
FFVTAAWSIF AYTWLYIILS VSSPGVVEVW EGLLTFFFFP ICVVFAWVAD
260 270 280 290 300
RRLLFYKYVY KRYRAGKQRG MIIEHEGDRP ASKTEIEMDG KVVNSHVDNF
310 320 330 340 350
LDGALVLEVD ERDQDDEEAR REMARILKEL KQKHPDKEIE QLIELANYQV
360 370 380 390 400
LSQQQKSRAF YRIQATRLMT GAGNILKRHA ADQARKAVSM HEVNMDVVEN
410 420 430 440 450
DPVSKVFFEQ GTYQCLENCG TVALTIIRRG GDLTNTVFVD FRTEDGTANA
460 470 480 490 500
GSDYEFTEGT VIFKPGETQK EIRVGIIDDD IFEEDENFLV HLSNVRVSSE
510 520 530 540 550
VSEDGILDSN HVSAIACLGS PNTATITIFD DDHAGIFTFE EPVTHVSESI
560 570 580 590 600
GIMEVKVLRT SGARGNVIIP YKTIEGTARG GGEDFEDTCG ELEFQNDEIV
610 620 630 640 650
KTISVKVIDD EEYEKNKTFF IEIGEPRLVE MSEKKALLLN ELGGFTLTEG
660 670 680 690 700
KKMYGQPVFR KVHARDHPIP STVISISEEY DDKQPLTSKE EEERRIAEMG
710 720 730 740 750
RPILGEHTKL EVIIEESYEF KSTVDKLIKK TNLALVVGTN SWREQFIEAI
760 770 780 790 800
TVSAGEDDDD DECGEEKLPS CFDYVMHFLT VFWKVLFAFV PPTEYWNGWA
810 820 830 840 850
CFIVSILMIG LLTAFIGDLA SHFGCTIGLK DSVTAVVFVA LGTSVPDTFA
860 870 880 890 900
SKVAATQDQY ADASIGNVTG SNAVNVFLGI GVAWSIAAIY HAANGEQFKV
910 920 930 940 950
SPGTLAFSVT LFTIFAFINV GVLLYRRRPE IGGELGGPRT AKLLTSSLFV
960 970
LLWLLYIFFS SLEAYCHIKG F
Length:971
Mass (Da):108,185
Last modified:February 1, 1996 - v3
Checksum:iEC456CFE3AFC6A69
GO
Isoform 2 (identifier: Q01728-2) [UniParc]FASTAAdd to basket
Also known as: Brain-1, NaCa5

The sequence of this isoform differs from the canonical sequence as follows:
     636-642: Missing.
     649-654: Missing.

Show »
Length:958
Mass (Da):106,681
Checksum:i1F2B3B90E7F5E3D8
GO
Isoform 3 (identifier: Q01728-3) [UniParc]FASTAAdd to basket
Also known as: Brain-2, NaCa4

The sequence of this isoform differs from the canonical sequence as follows:
     636-642: Missing.
     649-677: Missing.

Show »
Length:935
Mass (Da):104,157
Checksum:i40F966A2E0984167
GO
Isoform 4 (identifier: Q01728-4) [UniParc]FASTAAdd to basket
Also known as: Kidney-1, NaCa7, SNCX1

The sequence of this isoform differs from the canonical sequence as follows:
     602-635: TISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKK → IITIRIFDREEYEKECSFSLVLEEPKWIRRGMK
     636-642: Missing.
     649-654: Missing.

Show »
Length:957
Mass (Da):106,751
Checksum:iD4603BC36F1787E8
GO
Isoform 5 (identifier: Q01728-5) [UniParc]FASTAAdd to basket
Also known as: Kidney-2, NaCa3, RNCX1

The sequence of this isoform differs from the canonical sequence as follows:
     602-635: TISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKK → IITIRIFDREEYEKECSFSLVLEEPKWIRRGMK
     636-642: Missing.
     649-677: Missing.

Show »
Length:934
Mass (Da):104,227
Checksum:i24E41720DFC99776
GO
Isoform 6 (identifier: Q01728-6) [UniParc]FASTAAdd to basket
Also known as: SDNCX1.10

The sequence of this isoform differs from the canonical sequence as follows:
     602-635: TISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKK → IITIRIFDREEYEKECSFSLVLEEPKWIRRGMK
     636-642: Missing.
     649-649: Missing.

Show »
Length:962
Mass (Da):107,359
Checksum:iD0EC796D48D5D883
GO
Isoform 7 (identifier: Q01728-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     602-635: TISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKK → IITIRIFDREEYEKECSFSLVLEEPKWIRRGMK
     649-649: Missing.

Show »
Length:969
Mass (Da):108,126
Checksum:i7C9C7E57A323AD8F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti148L → P in AAD23388 (PubMed:10894800).Curated1
Sequence conflicti148L → P in AAD23389 (PubMed:10894800).Curated1
Sequence conflicti148L → P in AAK52307 (PubMed:15040000).Curated1
Sequence conflicti218I → F in AAD23387 (PubMed:10894800).Curated1
Sequence conflicti250D → A in CAA48273 (PubMed:8422940).Curated1
Sequence conflicti402P → A in CAA48273 (PubMed:8422940).Curated1
Sequence conflicti438F → S in AAD23386 (PubMed:10894800).Curated1
Sequence conflicti438F → S in AAD23387 (PubMed:10894800).Curated1
Sequence conflicti500E → G in AAD23388 (PubMed:10894800).Curated1
Sequence conflicti500E → G in AAK52307 (PubMed:15040000).Curated1
Sequence conflicti789F → N (PubMed:1415740).Curated1
Sequence conflicti861A → R (PubMed:1415740).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_003401602 – 635TISVK…MSEKK → IITIRIFDREEYEKECSFSL VLEEPKWIRRGMK in isoform 4, isoform 5, isoform 6 and isoform 7. 4 PublicationsAdd BLAST34
Alternative sequenceiVSP_003402636 – 642Missing in isoform 2, isoform 3, isoform 4, isoform 5 and isoform 6. 5 Publications7
Alternative sequenceiVSP_003404649 – 677Missing in isoform 3 and isoform 5. 2 PublicationsAdd BLAST29
Alternative sequenceiVSP_003403649 – 654Missing in isoform 2 and isoform 4. 4 Publications6
Alternative sequenceiVSP_029836649Missing in isoform 6 and isoform 7. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X68191 mRNA. Translation: CAA48273.1.
X68812 mRNA. Translation: CAA48707.1.
X68813 mRNA. Translation: CAA48708.1.
U04933 mRNA. Translation: AAB39952.1.
U04934 mRNA. Translation: AAA19124.1.
U04936 mRNA. Translation: AAA19125.1.
AF109163 mRNA. Translation: AAD23386.1.
AF109164 mRNA. Translation: AAD23387.1.
AF109165 mRNA. Translation: AAD23388.1.
AF109166 mRNA. Translation: AAD23389.1.
AY033398 mRNA. Translation: AAK52307.1.
PIRiA53789.
I52640.
S28833.
S32435.
S43730.
RefSeqiNP_001257701.1. NM_001270772.1. [Q01728-3]
NP_001257702.1. NM_001270773.1. [Q01728-5]
NP_001257703.1. NM_001270774.1. [Q01728-2]
NP_001257704.1. NM_001270775.1. [Q01728-4]
NP_001257705.1. NM_001270776.1. [Q01728-7]
NP_001257706.1. NM_001270777.1. [Q01728-6]
XP_008762655.1. XM_008764433.2. [Q01728-7]
XP_008762659.1. XM_008764437.2. [Q01728-6]
XP_008762660.1. XM_008764438.2. [Q01728-2]
XP_008762661.1. XM_008764439.2. [Q01728-4]
XP_017449552.1. XM_017594063.1. [Q01728-3]
XP_017449553.1. XM_017594064.1. [Q01728-5]
UniGeneiRn.118972.
Rn.935.

Genome annotation databases

EnsembliENSRNOT00000042230; ENSRNOP00000040751; ENSRNOG00000008479. [Q01728-1]
ENSRNOT00000042251; ENSRNOP00000040765; ENSRNOG00000008479. [Q01728-3]
ENSRNOT00000043870; ENSRNOP00000044094; ENSRNOG00000008479. [Q01728-7]
ENSRNOT00000046246; ENSRNOP00000043539; ENSRNOG00000008479. [Q01728-6]
ENSRNOT00000052367; ENSRNOP00000050918; ENSRNOG00000008479. [Q01728-2]
GeneIDi29715.
KEGGirno:29715.
UCSCiRGD:3717. rat. [Q01728-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X68191 mRNA. Translation: CAA48273.1.
X68812 mRNA. Translation: CAA48707.1.
X68813 mRNA. Translation: CAA48708.1.
U04933 mRNA. Translation: AAB39952.1.
U04934 mRNA. Translation: AAA19124.1.
U04936 mRNA. Translation: AAA19125.1.
AF109163 mRNA. Translation: AAD23386.1.
AF109164 mRNA. Translation: AAD23387.1.
AF109165 mRNA. Translation: AAD23388.1.
AF109166 mRNA. Translation: AAD23389.1.
AY033398 mRNA. Translation: AAK52307.1.
PIRiA53789.
I52640.
S28833.
S32435.
S43730.
RefSeqiNP_001257701.1. NM_001270772.1. [Q01728-3]
NP_001257702.1. NM_001270773.1. [Q01728-5]
NP_001257703.1. NM_001270774.1. [Q01728-2]
NP_001257704.1. NM_001270775.1. [Q01728-4]
NP_001257705.1. NM_001270776.1. [Q01728-7]
NP_001257706.1. NM_001270777.1. [Q01728-6]
XP_008762655.1. XM_008764433.2. [Q01728-7]
XP_008762659.1. XM_008764437.2. [Q01728-6]
XP_008762660.1. XM_008764438.2. [Q01728-2]
XP_008762661.1. XM_008764439.2. [Q01728-4]
XP_017449552.1. XM_017594063.1. [Q01728-3]
XP_017449553.1. XM_017594064.1. [Q01728-5]
UniGeneiRn.118972.
Rn.935.

3D structure databases

ProteinModelPortaliQ01728.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi248332. 9 interactors.
IntActiQ01728. 1 interactor.
MINTiMINT-4563844.
STRINGi10116.ENSRNOP00000040751.

PTM databases

iPTMnetiQ01728.
PhosphoSitePlusiQ01728.
SwissPalmiQ01728.

Proteomic databases

PaxDbiQ01728.
PRIDEiQ01728.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000042230; ENSRNOP00000040751; ENSRNOG00000008479. [Q01728-1]
ENSRNOT00000042251; ENSRNOP00000040765; ENSRNOG00000008479. [Q01728-3]
ENSRNOT00000043870; ENSRNOP00000044094; ENSRNOG00000008479. [Q01728-7]
ENSRNOT00000046246; ENSRNOP00000043539; ENSRNOG00000008479. [Q01728-6]
ENSRNOT00000052367; ENSRNOP00000050918; ENSRNOG00000008479. [Q01728-2]
GeneIDi29715.
KEGGirno:29715.
UCSCiRGD:3717. rat. [Q01728-1]

Organism-specific databases

CTDi6546.
RGDi3717. Slc8a1.

Phylogenomic databases

eggNOGiKOG1306. Eukaryota.
ENOG410XPJP. LUCA.
GeneTreeiENSGT00730000110414.
HOGENOMiHOG000266971.
HOVERGENiHBG006441.
InParanoidiQ01728.
KOiK05849.
OMAiDDEECGE.
OrthoDBiEOG091G0EC1.
PhylomeDBiQ01728.
TreeFamiTF314308.

Enzyme and pathway databases

ReactomeiR-RNO-418359. Reduction of cytosolic Ca++ levels.
R-RNO-425561. Sodium/Calcium exchangers.
R-RNO-5578775. Ion homeostasis.

Miscellaneous databases

PROiQ01728.

Gene expression databases

ExpressionAtlasiQ01728. baseline and differential.
GenevisibleiQ01728. RN.

Family and domain databases

InterProiIPR003644. Calx_beta.
IPR001623. DnaJ_domain.
IPR004836. Na_Ca_Ex.
IPR032452. Na_Ca_Ex_C-exten.
IPR002987. NaCa_exhngr1.
IPR004837. NaCa_Exmemb.
[Graphical view]
PfamiPF03160. Calx-beta. 2 hits.
PF01699. Na_Ca_ex. 2 hits.
PF16494. Na_Ca_ex_C. 1 hit.
[Graphical view]
PRINTSiPR01259. NACAEXCHNGR.
PR01260. NACAEXCHNGR1.
SMARTiSM00237. Calx_beta. 2 hits.
[Graphical view]
TIGRFAMsiTIGR00845. caca. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiNAC1_RAT
AccessioniPrimary (citable) accession number: Q01728
Secondary accession number(s): Q924Y2
, Q9QW49, Q9R238, Q9R239, Q9WU29, Q9WU30
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: February 1, 1996
Last modified: November 30, 2016
This is version 150 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.